LXL04_030316 | RubberDandelionOmics

Gene overview

LXL04_030316

Reference: OH-1004 Chr: Chr06 Coordinates: 114140263-114146421 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3975 bp · LXL04_030316|LXL04_030316|OH1004|cDNA

ATGCTGCATGGACGGTGGTGGTTTGGTGAAATGACCAAAGGACCATGTCAGGGGCTGAGGAAGATGATGGGTAGAAGTGCCAACGGAGGTTGCGGCACTGAGGAAAAACATTGCCCAGTTTCTATTTCTAGGGTTCCGACCAAGTTTTCACCGGAAGATAAAGACGCACCACTGGCTCGTCTAGTAGGTATAGATTTTTACGCCCAGGCTTGTAAGGCCCTTGCTGTTCTTTCCCCTTTCGATTTGGAGGATGGGCAGAA...

CDS

Download CDS FASTA

3975 bp · LXL04_030316|LXL04_030316|OH1004|CDS

ATGCTGCATGGACGGTGGTGGTTTGGTGAAATGACCAAAGGACCATGTCAGGGGCTGAGGAAGATGATGGGTAGAAGTGCCAACGGAGGTTGCGGCACTGAGGAAAAACATTGCCCAGTTTCTATTTCTAGGGTTCCGACCAAGTTTTCACCGGAAGATAAAGACGCACCACTGGCTCGTCTAGTAGGTATAGATTTTTACGCCCAGGCTTGTAAGGCCCTTGCTGTTCTTTCCCCTTTCGATTTGGAGGATGGGCAGAA...

Protein

Download Protein FASTA

1324 aa · LXL04_030316|LXL04_030316|OH1004|PROTEIN

MLHGRWWFGEMTKGPCQGLRKMMGRSANGGCGTEEKHCPVSISRVPTKFSPEDKDAPLARLVGIDFYAQACKALAVLSPFDLEDGQKKSSAIVSTLPGGLASCLSKHSDSRKRHKKSHLGSDTKKNKSSSRQEKPRGNTFWSETEDYFRELKGDDIERLNEASSFRGNKFISIPYPGNNNETNNHSGVVVASGEDQDVNHSMEVDDTCTNEISNNQREDDTACSLPQSSSGVEWLLGSRSKTYLTSDRPSKKRKIIGGEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030316`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_030316`
Location	Chr06:114140263-114146421 (-)
Description	Similar to Jade3: Protein Jade-3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030316` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0001558 regulation of cell growth Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0060828 regulation of canonical Wnt signaling pathway Biological Process GO:2000278 regulation of DNA biosynthetic process Biological Process GO:0000123 histone acetyltransferase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	mmu:382207 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · LXL04_030316 · OH-1004

Cytoplasm0.078

Rank 2 · LXL04_030316 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_030316 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_030316 · OH-1004

Plastid0.012

Rank 5 · LXL04_030316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13831.13PHD_2293-327 aa

PF13832.13zf-HC5HC2H_2339-444 aa

PF13771.13zf-HC5HC2H370-461 aa

PF29035.1DUF8494491-539 aa

PF00628.36PHD921-964 aa

PF13831.13PHD_2932-965 aa

PF13832.13zf-HC5HC2H_2991-1097 aa

PF13771.13zf-HC5HC2H1012-1098 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030316	`PF13831.13`	PHD_2	293	327	1.9e-15	56.8
LXL04_030316	`PF13832.13`	zf-HC5HC2H_2	339	444	8.8e-39	132.8
LXL04_030316	`PF13771.13`	zf-HC5HC2H	370	461	9.1e-30	103.4
LXL04_030316	`PF29035.1`	DUF8494	491	539	7.1e-22	77.9
LXL04_030316	`PF00628.36`	PHD	921	964	1.4e-06	29.0
LXL04_030316	`PF13831.13`	PHD_2	932	965	1.9e-15	56.8
LXL04_030316	`PF13832.13`	zf-HC5HC2H_2	991	1097	8.8e-39	132.8
LXL04_030316	`PF13771.13`	zf-HC5HC2H	1012	1098	9.1e-30	103.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card