LXL04_030305 | RubberDandelionOmics

Gene overview

LXL04_030305

Reference: OH-1004 Chr: Chr06 Coordinates: 113930939-113933790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2259 bp · LXL04_030305|LXL04_030305|OH1004|cDNA

ATGGCTCAGGGAAAGTACTCCCGAGTCGATGGAAAGAAGTCGTCATGTTCCACAGCAACAGTTATGGTAGTTTTCGGTGTTTGTTTAATTGGTGTATGGATGTCCATGTCATCATCCGTCGCCCCTGGTCAAATTCTGGACTTGCCAGCTCAGCATTCCAAAACAGAGTTAAAAGCGAAGGTGTCCGCAAACCCTTCTCCCCAATTTGAAGACAATTCTGGTGACTTACCAGAAGATGCAATCAAGGATGGAGTTAATCA...

CDS

Download CDS FASTA

2259 bp · LXL04_030305|LXL04_030305|OH1004|CDS

ATGGCTCAGGGAAAGTACTCCCGAGTCGATGGAAAGAAGTCGTCATGTTCCACAGCAACAGTTATGGTAGTTTTCGGTGTTTGTTTAATTGGTGTATGGATGTCCATGTCATCATCCGTCGCCCCTGGTCAAATTCTGGACTTGCCAGCTCAGCATTCCAAAACAGAGTTAAAAGCGAAGGTGTCCGCAAACCCTTCTCCCCAATTTGAAGACAATTCTGGTGACTTACCAGAAGATGCAATCAAGGATGGAGTTAATCA...

Protein

Download Protein FASTA

752 aa · LXL04_030305|LXL04_030305|OH1004|PROTEIN

MAQGKYSRVDGKKSSCSTATVMVVFGVCLIGVWMSMSSSVAPGQILDLPAQHSKTELKAKVSANPSPQFEDNSGDLPEDAIKDGVNQETNQGTDEKTSDAEDPPKMEVNDEKPTSRTEESNTKDLENGDEKINEERPTSRNEESNTGDESDSSESGKSKSKLKSEDEDNKKTETSPPADQSEILQETRTENRAFSTQEAESANEKESREPDVLKYQDVYEWKTCNVTTGPDFIPCLDNIGALKTIHTTLHYEHRERHCPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030305`
TK1151 ID	TkA07G396190
OH-1004 ID	LXL04_030305
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030305

Location Chr06:113930939-113933790 (+)

Description Similar to At5g64030: Probable methyltransferase PMT26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64030`	Probable methyltransferase PMT26.	No verified direct reference in this release
`At1g29470`	Probable methyltransferase PMT24.	No verified direct reference in this release
`At2g34300`	Probable methyltransferase PMT25.	No verified direct reference in this release
`At3g51070`	Probable methyltransferase PMT27.	No verified direct reference in this release
`At2g40280`	Probable methyltransferase PMT23.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030305 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G29470

ath:AT2G34300

ath:AT3G51070

ath:AT5G64030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.771

Rank 1 · LXL04_030305 · OH-1004

Cell membrane0.080

Rank 2 · LXL04_030305 · OH-1004

Endoplasmic reticulum0.077

Rank 3 · LXL04_030305 · OH-1004

Extracellular0.074

Rank 4 · LXL04_030305 · OH-1004

Cytoplasm0.046

Rank 5 · LXL04_030305 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_29231-734 aa

PF13649.13Methyltransf_25349-441 aa

PF08241.19Methyltransf_11350-444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030305	`PF03141.23`	Methyltransf_29	231	734	1.4e-229	763.6
LXL04_030305	`PF13649.13`	Methyltransf_25	349	441	1.5e-07	32.7
LXL04_030305	`PF08241.19`	Methyltransf_11	350	444	1.2e-10	42.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7V3`	Arabidopsis thaliana	Probable methyltransferase PMT26	56.747%	Swiss-Prot	strong database homology
`Q6NPR7`	Arabidopsis thaliana	Probable methyltransferase PMT24	59.259%	Swiss-Prot	strong database homology
`Q0WT31`	Arabidopsis thaliana	Probable methyltransferase PMT25	59.515%	Swiss-Prot	strong database homology
`Q9SD39`	Arabidopsis thaliana	Probable methyltransferase PMT27	60.462%	Swiss-Prot	strong database homology
`Q9SIZ3`	Arabidopsis thaliana	Probable methyltransferase PMT23	54.183%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card