LXL04_030301 | RubberDandelionOmics

Gene overview

LXL04_030301

Reference: OH-1004 Chr: Chr06 Coordinates: 113831912-113834682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · LXL04_030301|LXL04_030301|OH1004|cDNA

ATGTCGATCTTTGAGTACAATGGAAGCGCCCTGGTGGCCATGGTGGGAAAGAATTGCTTTGCTATTGCCAGTGATCGGAGGCTAGGTGTCCAGCTACAAACCATAGCAACTGATTTCCAACGAATTTTCAAGATCCATGACAAGCTCTTTCTTGGTCTCTCTGGTCTTGGCTCTGACGCACAAACACTCCATCAGAGGCTTGTGTTTCGCCACAAACTTTATCAACTTAGGGAAGAAAGAGACATGAAGCCTGAAACTTT...

CDS

Download CDS FASTA

615 bp · LXL04_030301|LXL04_030301|OH1004|CDS

ATGTCGATCTTTGAGTACAATGGAAGCGCCCTGGTGGCCATGGTGGGAAAGAATTGCTTTGCTATTGCCAGTGATCGGAGGCTAGGTGTCCAGCTACAAACCATAGCAACTGATTTCCAACGAATTTTCAAGATCCATGACAAGCTCTTTCTTGGTCTCTCTGGTCTTGGCTCTGACGCACAAACACTCCATCAGAGGCTTGTGTTTCGCCACAAACTTTATCAACTTAGGGAAGAAAGAGACATGAAGCCTGAAACTTT...

Protein

Download Protein FASTA

204 aa · LXL04_030301|LXL04_030301|OH1004|PROTEIN

MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLFLGLSGLGSDAQTLHQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFICTMDSIGAKELAKDFVVAGTASESLYGACESMFKPDMDHEELFETVSQALLSSVDRDCLSGWGGHVYVVTPTEVTERILKGRMD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030301`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030301

Location Chr06:113831912-113834682 (+)

Description Similar to PBC1: Proteasome subunit beta type-3-A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21720`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release
`At1g77440`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0643100`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030301 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005839 proteasome core complex Cellular Component

GO:0019774 proteasome core complex, beta-subunit complex Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G21720

ath:AT1G77440

ddi:DDB_G0269772

dosa:Os06g0643100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.734

Rank 1 · LXL04_030301 · OH-1004

Nucleus0.547

Rank 2 · LXL04_030301 · OH-1004

Mitochondrion0.069

Rank 3 · LXL04_030301 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_030301 · OH-1004

Cell membrane0.044

Rank 5 · LXL04_030301 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00227.32Proteasome7-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030301	`PF00227.32`	Proteasome	7	189	5.4e-46	157.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI05`	Arabidopsis thaliana	Proteasome subunit beta type-3-A	90.686%	Swiss-Prot	strong database homology
`O81153`	Arabidopsis thaliana	Proteasome subunit beta type-3-B	91.176%	Swiss-Prot	strong database homology
`Q9LST7`	Oryza sativa subsp. japonica	Proteasome subunit beta type-3	86.275%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card