LXL04_030298 | RubberDandelionOmics

Gene overview

LXL04_030298

Reference: OH-1004 Chr: Chr06 Coordinates: 113815865-113817335 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · LXL04_030298|LXL04_030298|OH1004|cDNA

ATGAGTTACCATACAGTAATGGGAAGAGGAAAGATCGAAGTGAAGAGAATTGAGAACAACACAAGTAGGCAAGTGACGTTTTCTAAGAGAAGAACTGGGCTTCTTAAGAAGACACATGAGCTCTCTGTTCTTTGTGATGCTCAAATTGGCCTCATTGTCTTCTCTAGCAAAGGGAAACTTTTTGAGTACGCAACTCAACCTCTCAGCATGTCGCAAATCATAGACAGATATTTGAAAGCAACTGGTTCTCGTATCCCTGA...

CDS

Download CDS FASTA

816 bp · LXL04_030298|LXL04_030298|OH1004|CDS

ATGAGTTACCATACAGTAATGGGAAGAGGAAAGATCGAAGTGAAGAGAATTGAGAACAACACAAGTAGGCAAGTGACGTTTTCTAAGAGAAGAACTGGGCTTCTTAAGAAGACACATGAGCTCTCTGTTCTTTGTGATGCTCAAATTGGCCTCATTGTCTTCTCTAGCAAAGGGAAACTTTTTGAGTACGCAACTCAACCTCTCAGCATGTCGCAAATCATAGACAGATATTTGAAAGCAACTGGTTCTCGTATCCCTGA...

Protein

Download Protein FASTA

271 aa · LXL04_030298|LXL04_030298|OH1004|PROTEIN

MSYHTVMGRGKIEVKRIENNTSRQVTFSKRRTGLLKKTHELSVLCDAQIGLIVFSSKGKLFEYATQPLSMSQIIDRYLKATGSRIPEHNNREHMHSELTRMKKETLNLQLSLQRYKGDDLSSAQLEELNQLEQQLEYSVQKVRARKFQLLQQQVDNLQRTEKVLEKENEEMCHWLMGKQQEEMNQQQVAAMTELKLVGQEHQLFEQFPFYGSEEQPNSVLQLAANLPELQLHPYQYHRLQPTQPNLHQESTSTQHHIFGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030298`
TK1151 ID	TkA07G395780
OH-1004 ID	LXL04_030298
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.614 / OH-1004 95.203 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030298

Location Chr06:113815865-113817335 (+)

Description Similar to FBP24: MADS-box protein FBP24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0170300`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030298 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048316 seed development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os02g0170300

zma:542013

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_030298 · OH-1004

Cytoplasm0.116

Rank 2 · LXL04_030298 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_030298 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_030298 · OH-1004

Plastid0.010

Rank 5 · LXL04_030298 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF16-63 aa

PF01486.23K-box87-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030298	`PF00319.24`	SRF-TF	16	63	1.2e-24	86.2
LXL04_030298	`PF01486.23`	K-box	87	174	1.8e-20	73.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6H711`	Oryza sativa subsp. japonica	MADS-box transcription factor 29	47.303%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card