LXL04_030283 | RubberDandelionOmics

Gene overview

LXL04_030283

Reference: OH-1004 Chr: Chr06 Coordinates: 113530498-113535474 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1705 bp · LXL04_030283|LXL04_030283|OH1004|cDNA

ATGCTATTTTTTTGTAAAAAGTCCACATGGTAAATTAAAATTTTGTATAGATGTAAATGTTATAAGACACAAGTCACAAGGGCTGAAAGGGTTTTGTTGGTCTCTCTTCGTTTGCTGCCTGGTTATGGAAGATTTGCAGAAGCTACTGCTACGTGACCATGGTCTATCAGTTTCGACACTTCCGAATAAAGGTCGCTGCCTCTTCACTACTCGCGAATTCTCCCCAGGAGAAATTATATTATCCGAAGAACCTTATGTTT...

CDS

Download CDS FASTA

1623 bp · LXL04_030283|LXL04_030283|OH1004|CDS

CTGAAAGGGTTTTGTTGGTCTCTCTTCGTTTGCTGCCTGGTTATGGAAGATTTGCAGAAGCTACTGCTACGTGACCATGGTCTATCAGTTTCGACACTTCCGAATAAAGGTCGCTGCCTCTTCACTACTCGCGAATTCTCCCCAGGAGAAATTATATTATCCGAAGAACCTTATGTTTCTGTACCAAACAAAAGTCCAGTGGAATCTCGATGCGATTGGTGCTTTACATCAAGTAATGTGAAGAGATGTTCATCTTGTCA...

Protein

Download Protein FASTA

540 aa · LXL04_030283|LXL04_030283|OH1004|PROTEIN

MKGFCWSLFVCCLVMEDLQKLLLRDHGLSVSTLPNKGRCLFTTREFSPGEIILSEEPYVSVPNKSPVESRCDWCFTSSNVKRCSSCQVVWYCGSKCQASDWKLHRLECQLLSKLEKNRIKSLTPSIRLMVKLYLRRKLQDEKVIPTSVTDNYNLVKELVSHISEVEETQLVLYAQMASLVNIILQWPTLNVKEIAENFSKLACNAHTICDSELIPLGTGLFPVISIINHSCSPNSVLVFEGRMATVRAMHQIPKGSEVLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030283`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030283

Location Chr06:113530498-113535474 (-)

Description Similar to ASHR1: Histone-lysine N-methyltransferase ASHR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17900`	Histone methyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006334 nucleosome assembly Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006469 negative regulation of protein kinase activity Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0018026 peptidyl-lysine monomethylation Biological Process

GO:0018027 peptidyl-lysine dimethylation Biological Process

GO:0032259 methylation Biological Process

GO:0033138 positive regulation of peptidyl-serine phosphorylation Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

mmu:69726

xla:379943

xla:444415

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · LXL04_030283 · OH-1004

Nucleus0.442

Rank 2 · LXL04_030283 · OH-1004

Mitochondrion0.136

Rank 3 · LXL04_030283 · OH-1004

Cell membrane0.050

Rank 4 · LXL04_030283 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_030283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00856.34SET37-262 aa

PF01753.25zf-MYND71-108 aa

PF13424.13TPR_12397-461 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030283	`PF00856.34`	SET	37	262	1.9e-11	45.0
LXL04_030283	`PF01753.25`	zf-MYND	71	108	6.8e-10	39.6
LXL04_030283	`PF13424.13`	TPR_12	397	461	3e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJS0`	Arabidopsis thaliana	Histone-lysine N-methyltransferase ASHR1	58.238%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card