LXL04_030261 | RubberDandelionOmics

Gene overview

LXL04_030261

Reference: OH-1004 Chr: Chr06 Coordinates: 112806413-112806766 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · LXL04_030261|LXL04_030261|OH1004|cDNA

ATGTCCGTCTCGGCGATCTTCGGTGTCCAACTCGCTGCCATCTCCGCAGCCCCTCCTCTCCGTCAATCATCCTACACTGCCACTACGAAGGTCGCTTCTCCGGCAGTCAAGTATGGACGCGAAATTGGAAACAATACAGGGTTAACGATCGAGTGCTCATCGAGGCCACAGAAGAAGGCGACAGCACACCACCGGAAAACAAGGCCGAAGAAGACTGCCGCGTGGGACAGAAACCGTGGGCCTGCTGTTTACCCACCTCT...

CDS

Download CDS FASTA

354 bp · LXL04_030261|LXL04_030261|OH1004|CDS

ATGTCCGTCTCGGCGATCTTCGGTGTCCAACTCGCTGCCATCTCCGCAGCCCCTCCTCTCCGTCAATCATCCTACACTGCCACTACGAAGGTCGCTTCTCCGGCAGTCAAGTATGGACGCGAAATTGGAAACAATACAGGGTTAACGATCGAGTGCTCATCGAGGCCACAGAAGAAGGCGACAGCACACCACCGGAAAACAAGGCCGAAGAAGACTGCCGCGTGGGACAGAAACCGTGGGCCTGCTGTTTACCCACCTCT...

Protein

Download Protein FASTA

117 aa · LXL04_030261|LXL04_030261|OH1004|PROTEIN

MSVSAIFGVQLAAISAAPPLRQSSYTATTKVASPAVKYGREIGNNTGLTIECSSRPQKKATAHHRKTRPKKTAAWDRNRGPAVYPPLPDLPPEWSFVTEEAVEASSSSAPSPPPESA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030261`
TK1151 ID	TkA07G391560
OH-1004 ID	LXL04_030261
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 91.406 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030261

Location Chr06:112806413-112806766 (-)

Description Similar to PSRP6: 50S ribosomal protein 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17870`	Large ribosomal subunit protein cL38.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030261 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

GO:0019843 rRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G17870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_030261 · OH-1004

Nucleus0.025

Rank 2 · LXL04_030261 · OH-1004

Mitochondrion0.021

Rank 3 · LXL04_030261 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_030261 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_030261 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17257.8DUF532345-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030261	`PF17257.8`	DUF5323	45	101	8.6e-34	116.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKP0`	Arabidopsis thaliana	Large ribosomal subunit protein cL38	50.459%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card