LXL04_030254 | RubberDandelionOmics

Gene overview

LXL04_030254

Reference: OH-1004 Chr: Chr06 Coordinates: 112447643-112450894 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2940 bp · LXL04_030254|LXL04_030254|OH1004|cDNA

ATGGGCTTTCACtatattttcatcttttatcTTGTATTATTACTTCCATTAATATCAAGCTCTTATGAAGCTTCAATGGCGGATCAAGCTGAGTTCTTCCCCCTCATGAAGAATTCTCTAACAGGATCTTTTTTAAACGATTGGGATGATAAACCAGTCTGCAATTATAAAGGTGTTATCTGTGATCAAGAAGGGTACGTAGTGAAGATTGATATTTCCGGGCAGGGGCTTTTCGGTCATTTCCCAGAAAACGTATGCTC...

CDS

Download CDS FASTA

2940 bp · LXL04_030254|LXL04_030254|OH1004|CDS

ATGGGCTTTCACTATATTTTCATCTTTTATCTTGTATTATTACTTCCATTAATATCAAGCTCTTATGAAGCTTCAATGGCGGATCAAGCTGAGTTCTTCCCCCTCATGAAGAATTCTCTAACAGGATCTTTTTTAAACGATTGGGATGATAAACCAGTCTGCAATTATAAAGGTGTTATCTGTGATCAAGAAGGGTACGTAGTGAAGATTGATATTTCCGGGCAGGGGCTTTTCGGTCATTTCCCAGAAAACGTATGCTC...

Protein

Download Protein FASTA

979 aa · LXL04_030254|LXL04_030254|OH1004|PROTEIN

MGFHYIFIFYLVLLLPLISSSYEASMADQAEFFPLMKNSLTGSFLNDWDDKPVCNYKGVICDQEGYVVKIDISGQGLFGHFPENVCSFVPRLRSLSFGYNKIHGDFPQSITNCSFLEQLNITHTNLTGTLPDLSPMKSLKLLDLSSNFFTGAFPMSFINLVNLEIVNFNENAGFDMWRLPENITKLVKLKSMILSTCKVSGTIPKSIGNMTSLVDLELSGNYLVGPVPREIGLLKNLQSLELYYNQLVGGIPEELGNLTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030254`
TK1151 ID	TkA07G390160
OH-1004 ID	LXL04_030254
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.613 / OH-1004 94.382 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030254

Location Chr06:112447643-112450894 (+)

Description Similar to CEPR1: Receptor protein-tyrosine kinase CEPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At1g09970`	Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).	RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4 The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331
`At1g28440`	Receptor-like protein kinase HSL1.	No verified direct reference in this release
`At1g72180`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	No verified direct reference in this release
`At3g19700`	Modulates the seed size by negatively regulating the cellularization of syncytial endosperm.	MINISEED3 (MINI3), a WRKY family gene, and HAIKU2 (IKU2), a leucine-rich repeat (LRR) KINASE gene, are regulators of seed size in Arabidopsis.2005 · DOI: 10.1073/pnas.0508418102

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030254 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009845 seed germination Biological Process

GO:0009960 endosperm development Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010555 response to mannitol Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048437 floral organ development Biological Process

KEGG gene cross-reference

ath:AT1G09970

ath:AT1G28440

ath:AT1G72180

ath:AT3G19700

ath:AT5G49660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.872

Rank 1 · LXL04_030254 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_030254 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_030254 · OH-1004

Nucleus0.036

Rank 4 · LXL04_030254 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_030254 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799.14LRR_490-134 aa

PF13855.13LRR_8188-247 aa

PF23598.2LRR_14229-316 aa

PF13855.13LRR_8260-319 aa

PF13855.13LRR_8385-439 aa

PF13855.13LRR_8452-511 aa

PF00069.32Pkinase647-858 aa

PF07714.24PK_Tyr_Ser-Thr648-863 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030254	`PF12799.14`	LRR_4	90	134	6.4e-23	81.0
LXL04_030254	`PF13855.13`	LRR_8	188	247	1.4e-28	99.1
LXL04_030254	`PF23598.2`	LRR_14	229	316	9.3e-21	74.7
LXL04_030254	`PF13855.13`	LRR_8	260	319	1.4e-28	99.1
LXL04_030254	`PF13855.13`	LRR_8	385	439	1.4e-28	99.1
LXL04_030254	`PF13855.13`	LRR_8	452	511	1.4e-28	99.1
LXL04_030254	`PF00069.32`	Pkinase	647	858	1.5e-47	162.9
LXL04_030254	`PF07714.24`	PK_Tyr_Ser-Thr	648	863	1.7e-38	133.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGL5`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR1	61.842%	Swiss-Prot	strong database homology
`F4I2N7`	Arabidopsis thaliana	Receptor-like protein kinase 7	40.182%	Swiss-Prot	moderate database homology
`Q9SGP2`	Arabidopsis thaliana	Receptor-like protein kinase HSL1	39.426%	Swiss-Prot	moderate database homology
`Q9C7T7`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR2	39.562%	Swiss-Prot	moderate database homology
`Q9LJM4`	Arabidopsis thaliana	Receptor-like protein kinase HAIKU2	36.493%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card