LXL04_030242 | RubberDandelionOmics

Gene overview

LXL04_030242

Reference: OH-1004 Chr: Chr06 Coordinates: 112244119-112245579 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · LXL04_030242|LXL04_030242|OH1004|cDNA

ATGGCTTCAATTCGGAGAACACTTTCACCGTATCAGGATCGTTCGCATCAAAATGGAGGGAATGTTAGTCCGTTCTCAGTGAATTCTCCTTCACATAAACTTAATCCAACCAGTAGATTCGCGCTGGGAGTGCGTAGATTTATAGGAGGCGAAAAACATAGTCTTCCTCGGAAAGGTTTTCGTACATGGAAGAGATCGATTTATAGTTGTTTATCGTTTTTCGTGGTAGGGTTTTTGTTAGGCTTGGCACCATTTGGGGA...

CDS

Download CDS FASTA

1191 bp · LXL04_030242|LXL04_030242|OH1004|CDS

ATGGCTTCAATTCGGAGAACACTTTCACCGTATCAGGATCGTTCGCATCAAAATGGAGGGAATGTTAGTCCGTTCTCAGTGAATTCTCCTTCACATAAACTTAATCCAACCAGTAGATTCGCGCTGGGAGTGCGTAGATTTATAGGAGGCGAAAAACATAGTCTTCCTCGGAAAGGTTTTCGTACATGGAAGAGATCGATTTATAGTTGTTTATCGTTTTTCGTGGTAGGGTTTTTGTTAGGCTTGGCACCATTTGGGGA...

Protein

Download Protein FASTA

396 aa · LXL04_030242|LXL04_030242|OH1004|PROTEIN

MASIRRTLSPYQDRSHQNGGNVSPFSVNSPSHKLNPTSRFALGVRRFIGGEKHSLPRKGFRTWKRSIYSCLSFFVVGFLLGLAPFGEFEDARSPDFSFEVKRPPILDVKEDIVVDKVELAVVKRENVKERFDYAARKQVIVVTPTYNRALQAYYLNRLGQVLRLVPPPVLWIVVEMNVASTETADILRGMGIMYRHLVCIKNLTNVKDRGVHQRNTALEHIEHHKLDGIVYFADDDNIYSLELFETLRDISRFGTWPVAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030242`
TK1151 ID	TkA07G387830
OH-1004 ID	LXL04_030242
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 55.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030242

Location Chr06:112244119-112245579 (-)

Description Similar to IRX9H: Probable beta-1,4-xylosyltransferase IRX9H

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27600`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0205300`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os01g0675500`	Probable beta-1,4-xylosyltransferase involved in xylan biosynthesis in cell walls.	Three Novel Rice Genes Closely Related to the Arabidopsis IRX9, IRX9L, and IRX14 Genes and Their Roles in Xylan Biosynthesis.2013 · DOI: 10.3389/fpls.2013.00083
`Os05g0559600`	Probable beta-1,4-xylosyltransferase involved in xylan biosynthesis in cell walls.	Functional roles of rice glycosyltransferase family GT43 in xylan biosynthesis.2014 · DOI: 10.4161/psb.27809
`Os04g0103100`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030242 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0015018 galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity Molecular Function

GO:0042285 xylosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G27600

dosa:Os01g0675500

dosa:Os04g0103100

dosa:Os05g0559600

dosa:Os10g0205300

osa:4325514

osa:4348270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.842

Rank 1 · LXL04_030242 · OH-1004

Endoplasmic reticulum0.075

Rank 2 · LXL04_030242 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_030242 · OH-1004

Cytoplasm0.046

Rank 4 · LXL04_030242 · OH-1004

Extracellular0.041

Rank 5 · LXL04_030242 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03360.22Glyco_transf_43158-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030242	`PF03360.22`	Glyco_transf_43	158	367	8.5e-74	248.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXC4`	Arabidopsis thaliana	Probable beta-1,4-xylosyltransferase IRX9H	65.649%	Swiss-Prot	strong database homology
`Q8S626`	Oryza sativa subsp. japonica	Probable glucuronosyltransferase Os10g0205300	52.410%	Swiss-Prot	strong database homology
`Q5QM25`	Oryza sativa subsp. japonica	Probable beta-1,4-xylosyltransferase IRX9L	57.200%	Swiss-Prot	moderate database homology
`Q6AT32`	Oryza sativa subsp. japonica	Probable beta-1,4-xylosyltransferase GT43E	41.989%	Swiss-Prot	moderate database homology
`Q7XTB2`	Oryza sativa subsp. japonica	Probable glucuronosyltransferase Os04g0103100	49.213%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card