LXL04_030196 | RubberDandelionOmics

Gene overview

LXL04_030196

Reference: OH-1004 Chr: Chr06 Coordinates: 110499781-110504202 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2379 bp · LXL04_030196|LXL04_030196|OH1004|cDNA

ATGATGCCTAATTCCAAAAACAACAGTGCCGATCCCAAAAACAGCGCGGATTCGAAAAGTCACGATTCTGTTTCGAAGAACCACGCCGCTGATTCGAAAAACAACAATGCTGATCACAAAAATAGCACTTCTGCTCCCAAACACAACGCTGATCTGACGAAAAGCATTTCTACATCCAGAAAAGATAATATTGATTGGAAAAACAGGATCGATTCCATAAGCCACGCCGATGCCCCTCCTCCTCAGggagatggtggtgg...

CDS

Download CDS FASTA

2379 bp · LXL04_030196|LXL04_030196|OH1004|CDS

ATGATGCCTAATTCCAAAAACAACAGTGCCGATCCCAAAAACAGCGCGGATTCGAAAAGTCACGATTCTGTTTCGAAGAACCACGCCGCTGATTCGAAAAACAACAATGCTGATCACAAAAATAGCACTTCTGCTCCCAAACACAACGCTGATCTGACGAAAAGCATTTCTACATCCAGAAAAGATAATATTGATTGGAAAAACAGGATCGATTCCATAAGCCACGCCGATGCCCCTCCTCCTCAGGGAGATGGTGGTGG...

Protein

Download Protein FASTA

792 aa · LXL04_030196|LXL04_030196|OH1004|PROTEIN

MMPNSKNNSADPKNSADSKSHDSVSKNHAADSKNNNADHKNSTSAPKHNADLTKSISTSRKDNIDWKNRIDSISHADAPPPQGDGGGGNLPPPSGTTQSLENLSPRSGNKVYKSGPLFLSSKGIGWTSWKKRWFILTETSLVFFRSDPNASSEKGGESNLTLGGIDLNSSGSVVVKADKKLLTVLFPDGRDGRSFTLKAETLEDLHEWKTALEEALANAPTAGTAIGQNGIPKNEKGENTDGGHEQTKDRSPPKSVVLGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030196`
TK1151 ID	TkA07G386130
OH-1004 ID	LXL04_030196
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030196

Location Chr06:110499781-110504202 (+)

Description Similar to REN1: Rho GTPase-activating protein REN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24580`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	A tip-localized RhoGAP controls cell polarity by globally inhibiting Rho GTPase at the cell apex.2008 · DOI: 10.1016/j.cub.2008.11.057
`At5g12150`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At5g19390`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030196 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009865 pollen tube adhesion Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0035024 negative regulation of Rho protein signal transduction Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:0048868 pollen tube development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005938 cell cortex Cellular Component

KEGG gene cross-reference

ath:AT4G24580

ath:AT5G12150

ath:AT5G19390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.494

Rank 1 · LXL04_030196 · OH-1004

Cytoplasm0.424

Rank 2 · LXL04_030196 · OH-1004

Nucleus0.224

Rank 3 · LXL04_030196 · OH-1004

Golgi apparatus0.062

Rank 4 · LXL04_030196 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_030196 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00169.36PH112-216 aa

PF00620.33RhoGAP275-416 aa

PF14389.12Lzipper-MIP1582-659 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030196	`PF00169.36`	PH	112	216	2.4e-13	51.2
LXL04_030196	`PF00620.33`	RhoGAP	275	416	3.2e-28	99.2
LXL04_030196	`PF14389.12`	Lzipper-MIP1	582	659	3.8e-18	66.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JQZ3`	Arabidopsis thaliana	Rho GTPase-activating protein REN1	70.896%	Swiss-Prot	moderate database homology
`Q9FMP8`	Arabidopsis thaliana	Rho GTPase-activating protein 6	65.217%	Swiss-Prot	weak database homology
`Q8RWQ4`	Arabidopsis thaliana	Rho GTPase-activating protein 7	67.935%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card