LXL04_030192 | RubberDandelionOmics

Gene overview

LXL04_030192

Reference: OH-1004 Chr: Chr06 Coordinates: 110460366-110460971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · LXL04_030192|LXL04_030192|OH1004|cDNA

AtgtcatcatcatcatcatcaacatcatTATCAGTACTATCACCGACACTGTCGCCGTCATCCTTGATCGGAAAAGAGAAATTCAAAGGAGTGCGAATGAGGAGTTGGGGTTCATGGGTTTCCGAAATCAGGGCACCAAATCAGAAATCAAGAATATGGTTAGGATCTTATTCAACTCCAGAAGCAGCCGCAAGAGCTTATGATGCAGCCGTTCTATGCGTTAAGGGCCCAACTGCAAATCTAAACTTTTCTCGCCACCA...

CDS

Download CDS FASTA

606 bp · LXL04_030192|LXL04_030192|OH1004|CDS

ATGTCATCATCATCATCATCAACATCATTATCAGTACTATCACCGACACTGTCGCCGTCATCCTTGATCGGAAAAGAGAAATTCAAAGGAGTGCGAATGAGGAGTTGGGGTTCATGGGTTTCCGAAATCAGGGCACCAAATCAGAAATCAAGAATATGGTTAGGATCTTATTCAACTCCAGAAGCAGCCGCAAGAGCTTATGATGCAGCCGTTCTATGCGTTAAGGGCCCAACTGCAAATCTAAACTTTTCTCGCCACCA...

Protein

Download Protein FASTA

201 aa · LXL04_030192|LXL04_030192|OH1004|PROTEIN

MSSSSSSTSLSVLSPTLSPSSLIGKEKFKGVRMRSWGSWVSEIRAPNQKSRIWLGSYSTPEAAARAYDAAVLCVKGPTANLNFSRHHYYHDSFTGTTAMSPKSIKKVAALAAAATTGPSPPPSPSCSSPLSPVSPSQSSSYDEKSERLISLESNPLDGTLMAMVAPWCNFDSPRYNDVMHNDSPFDTSDEEGGEIRLWSFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030192`
TK1151 ID	TkA07G385940
OH-1004 ID	LXL04_030192
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 84.080 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030192

Location Chr06:110460366-110460971 (-)

Description Similar to ERF012: Ethylene-responsive transcription factor ERF012

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21910`	Transcriptional activator involved in the regulation of plant development and tolerance to abiotic stresses.	Functional characterization of four APETALA2-family genes (RAP2.6, RAP2.6L, DREB19 and DREB26) in Arabidopsis.2011 · DOI: 10.1007/s11103-010-9711-7 Identification of Chimeric Repressors that Confer Salt and Osmotic Stress Tolerance in Arabidopsis.2013 · DOI: 10.3390/plants2040769
`At1g77640`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g50260`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g36900`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g67190`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030192 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071497 cellular response to freezing Biological Process

KEGG gene cross-reference

ath:AT1G21910

ath:AT1G77640

ath:AT3G50260

ath:AT4G36900

ath:AT5G67190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · LXL04_030192 · OH-1004

Cytoplasm0.115

Rank 2 · LXL04_030192 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_030192 · OH-1004

Endoplasmic reticulum0.025

Rank 4 · LXL04_030192 · OH-1004

Plastid0.021

Rank 5 · LXL04_030192 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP227-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030192	`PF00847.27`	AP2	27	76	9.2e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFE4`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF012	46.073%	Swiss-Prot	moderate database homology
`Q9CAP4`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF013	64.356%	Swiss-Prot	weak database homology
`Q9SNE1`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF011	75.000%	Swiss-Prot	weak database homology
`Q9SW63`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-10	51.807%	Swiss-Prot	weak database homology
`Q9FH94`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF010	73.214%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card