LXL04_030172 | RubberDandelionOmics

Gene overview

LXL04_030172

Reference: OH-1004 Chr: Chr06 Coordinates: 110052643-110055012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1029 bp · LXL04_030172|LXL04_030172|OH1004|cDNA

ATGGCTGATTGCTTGCTATCAAGCTTATTATGTGCCGAAGATAATGAAAGTTTATGTTATGATTCTGCTGATGCTCACAAGAATGTGGATGATGGATTCTCGAGCTATGGCAATTATCTAAAAATTAATCAAAATCTGTCAATAGTTAAGAATCATGATCCGGAGTACTCTGTTCACGATTTTCCTTTGCAAAGTGACGAGTGTTTATCTGTGCTGATTAAAAAAGAATGCGAACAGTTTGTTGGTTTGGATTATTTGAA...

CDS

Download CDS FASTA

1029 bp · LXL04_030172|LXL04_030172|OH1004|CDS

ATGGCTGATTGCTTGCTATCAAGCTTATTATGTGCCGAAGATAATGAAAGTTTATGTTATGATTCTGCTGATGCTCACAAGAATGTGGATGATGGATTCTCGAGCTATGGCAATTATCTAAAAATTAATCAAAATCTGTCAATAGTTAAGAATCATGATCCGGAGTACTCTGTTCACGATTTTCCTTTGCAAAGTGACGAGTGTTTATCTGTGCTGATTAAAAAAGAATGCGAACAGTTTGTTGGTTTGGATTATTTGAA...

Protein

Download Protein FASTA

342 aa · LXL04_030172|LXL04_030172|OH1004|PROTEIN

MADCLLSSLLCAEDNESLCYDSADAHKNVDDGFSSYGNYLKINQNLSIVKNHDPEYSVHDFPLQSDECLSVLIKKECEQFVGLDYLKKLRNGNLDFVARQQAIDWIKKAHAHFNFGPLCAYLSINYLDRFLAVYEFPNDKAWMMQLLAVTCLSLASKMEENEVPLILDLQVCESRFVFEAKTIQKMELLVLTTLKWRMQTVTPFSFIDAFIRKLDCNQPFSRSLILRSTQLILCLTNGIDFLEFKPSEIAAAVAVSVIGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030172`
TK1151 ID	TkA07G383880
OH-1004 ID	LXL04_030172
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030172

Location Chr06:110052643-110055012 (-)

Description Similar to CYCD4-1: Cyclin-D4-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65420`	May activate cell cycle in the root apical meristem (RAM) and promote embryonic root (radicle) protrusion.	No verified direct reference in this release
`At2g22490`	Acts on the G1 phase of the cell cycle to control cell division rate in both shoot and root meristems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0466100`	Cyclin-D4-1.	No verified direct reference in this release
`Os07g0620800`	Cyclin-D2-2.	No verified direct reference in this release
`Os06g0217900`	Cyclin-D3-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030172 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0051301 cell division Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT2G22490

ath:AT5G65420

dosa:Os06g0217900

dosa:Os07g0620800

dosa:Os09g0466100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · LXL04_030172 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_030172 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_030172 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_030172 · OH-1004

Plastid0.013

Rank 5 · LXL04_030172 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134.29Cyclin_N68-198 aa

PF02984.25Cyclin_C201-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030172	`PF00134.29`	Cyclin_N	68	198	8.9e-31	107.0
LXL04_030172	`PF02984.25`	Cyclin_C	201	286	7e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGA1`	Arabidopsis thaliana	Cyclin-D4-1	48.507%	Swiss-Prot	moderate database homology
`P42752`	Arabidopsis thaliana	Cyclin-D2-1	43.478%	Swiss-Prot	moderate database homology
`Q6YXH8`	Oryza sativa subsp. japonica	Cyclin-D4-1	48.658%	Swiss-Prot	moderate database homology
`Q8LHA8`	Oryza sativa subsp. japonica	Cyclin-D2-2	43.854%	Swiss-Prot	moderate database homology
`Q69QB8`	Oryza sativa subsp. japonica	Cyclin-D3-1	42.373%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card