LXL04_030136 | RubberDandelionOmics

Gene overview

LXL04_030136

Reference: OH-1004 Chr: Chr06 Coordinates: 109040350-109043184 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · LXL04_030136|LXL04_030136|OH1004|cDNA

ATGGAAAGATATGAACTTGTTAAAGAAATCGGGTCGGGTAATTTTGGGGTAGCGAAGCTTGTTAGGGACAAGGGGACCAGAGAGCTATTTGCTGTCAAGTTTATCGAAAGGGGCAAAAAGATTGATGAACATGTACAGAGGGAAATTATGAATCATCGATCTTTGAGGCATCCGAATATTATCAGATTTAAAGAGGTGTTGCTAACACAAACTCATCTAGCAATAGTCATGGAGTATGCTGCTGGAGGAGAGCTTTTTGA...

CDS

Download CDS FASTA

1056 bp · LXL04_030136|LXL04_030136|OH1004|CDS

ATGGAAAGATATGAACTTGTTAAAGAAATCGGGTCGGGTAATTTTGGGGTAGCGAAGCTTGTTAGGGACAAGGGGACCAGAGAGCTATTTGCTGTCAAGTTTATCGAAAGGGGCAAAAAGATTGATGAACATGTACAGAGGGAAATTATGAATCATCGATCTTTGAGGCATCCGAATATTATCAGATTTAAAGAGGTGTTGCTAACACAAACTCATCTAGCAATAGTCATGGAGTATGCTGCTGGAGGAGAGCTTTTTGA...

Protein

Download Protein FASTA

351 aa · LXL04_030136|LXL04_030136|OH1004|PROTEIN

MERYELVKEIGSGNFGVAKLVRDKGTRELFAVKFIERGKKIDEHVQREIMNHRSLRHPNIIRFKEVLLTQTHLAIVMEYAAGGELFERICNAGKFSENEAIEKDGHFVSLNFPLLARFFFQQLISGVSYCHSMEVCHRDLKLENTLLDGSAAPRVKICDFGYSKSLVLHSQPKSAVGTPAYIAPEVLSRKEYNGKLADVWSCGVTLYVMLVGAYPFGVPDDPRNFRTTVCRILSVQYAIPDTVEISMECKHLLYRIFVAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030136`
TK1151 ID	TkA07G380820
OH-1004 ID	LXL04_030136
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030136

Location Chr06:109040350-109043184 (-)

Description Similar to SAPK2: Serine/threonine-protein kinase SAPK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78290`	Involved in gene regulation and confers tolerance to drought and osmotic stress.	SRK2C, a SNF1-related protein kinase 2, improves drought tolerance by controlling stress-responsive gene expression in Arabidopsis thaliana.2004 · DOI: 10.1073/pnas.0407758101

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YNT8`	May play a role in signal transduction of hyperosmotic response (By similarity).	No verified direct reference in this release
`Os07g0622000`	May play a role in signal transduction of hyperosmotic response (Probable).	A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.2012 · DOI: 10.1093/jxb/err338
`Os03g0390200`	May play a role in signal transduction of hyperosmotic response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030136 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0090351 seedling development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78290

dosa:Os03g0390200

dosa:Os07g0622000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.587

Rank 1 · LXL04_030136 · OH-1004

Nucleus0.442

Rank 2 · LXL04_030136 · OH-1004

Cell membrane0.110

Rank 3 · LXL04_030136 · OH-1004

Mitochondrion0.073

Rank 4 · LXL04_030136 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_030136 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase4-276 aa

PF07714.24PK_Tyr_Ser-Thr5-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030136	`PF00069.32`	Pkinase	4	276	6.5e-69	233.0
LXL04_030136	`PF07714.24`	PK_Tyr_Ser-Thr	5	271	8.4e-31	107.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E9`	Arabidopsis thaliana	Serine/threonine-protein kinase SRK2C	74.194%	Swiss-Prot	strong database homology
`A2YNT8`	Oryza sativa subsp. indica	Serine/threonine-protein kinase SAPK2	70.718%	Swiss-Prot	strong database homology
`Q0D4J7`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK2	74.462%	Swiss-Prot	strong database homology
`Q75LR7`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK1	74.766%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card