LXL04_030117 | RubberDandelionOmics

Gene overview

LXL04_030117

Reference: OH-1004 Chr: Chr06 Coordinates: 108519684-108523329 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1890 bp · LXL04_030117|LXL04_030117|OH1004|cDNA

ATGCCGATTCTTTGTTGCTTTCCTTCATTGGGACAAAGGAACAAGAAAAATAAGGAAGAGGATGATGATAATGAAAGGTTGCATGTGAAATTACAACAGTCGGGGAAGCCTATTGACCTTCAGTCAAAGTCAAGGTCAACATTCAGTGTAGATGTCCCCTTCTCTAACGTGAAGGTCGTCAGCCATGAAAGCCCTGTAAAAGCTCAGCTTCAAGCAGAAGAAGacgaagaaaaagaagaagcatACGAAGGGGAAGATGA...

CDS

Download CDS FASTA

1890 bp · LXL04_030117|LXL04_030117|OH1004|CDS

ATGCCGATTCTTTGTTGCTTTCCTTCATTGGGACAAAGGAACAAGAAAAATAAGGAAGAGGATGATGATAATGAAAGGTTGCATGTGAAATTACAACAGTCGGGGAAGCCTATTGACCTTCAGTCAAAGTCAAGGTCAACATTCAGTGTAGATGTCCCCTTCTCTAACGTGAAGGTCGTCAGCCATGAAAGCCCTGTAAAAGCTCAGCTTCAAGCAGAAGAAGACGAAGAAAAAGAAGAAGCATACGAAGGGGAAGATGA...

Protein

Download Protein FASTA

629 aa · LXL04_030117|LXL04_030117|OH1004|PROTEIN

MPILCCFPSLGQRNKKNKEEDDDNERLHVKLQQSGKPIDLQSKSRSTFSVDVPFSNVKVVSHESPVKAQLQAEEDEEKEEAYEGEDEHEKDYNSDHDRHREVFIGKMPMEEHDEYSNTNIDNHQSNSSDTEMNNDGHLSDPGASKPPLESSPKLKRSCSNLEAKRVSSINRIAPCESYEDLQKLGEGSISPVSITSNYSADKVILRKCSSSQILPSKSRKLWWKLLLWSHRNLHEPIKGVQNMLLVTNQQGGYSSDLEPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030117`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_030117`
Location	Chr06:108519684-108523329 (+)
Description	Similar to DNAAF1: Dynein assembly factor 1, axonemal
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030117` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0003341 cilium movement Biological Process GO:0003356 regulation of cilium beat frequency Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0035082 axoneme assembly Biological Process GO:0036158 outer dynein arm assembly Biological Process GO:0036159 inner dynein arm assembly Biological Process GO:0044458 motile cilium assembly Biological Process GO:0046600 negative regulation of centriole replication Biological Process GO:0060271 cilium assembly Biological Process GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry Biological Process GO:0060972 left/right pattern formation Biological Process GO:0070286 axonemal dynein complex assembly Biological Process
KEGG gene cross-reference	bta:523187 cel:CELE_T09A5.9 hsa:123872 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.569

Rank 1 · LXL04_030117 · OH-1004

Nucleus0.295

Rank 2 · LXL04_030117 · OH-1004

Cytoplasm0.288

Rank 3 · LXL04_030117 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_030117 · OH-1004

Golgi apparatus0.035

Rank 5 · LXL04_030117 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8396-451 aa

PF14580.13LRR_9400-504 aa

PF12799.14LRR_4419-454 aa

PF12799.14LRR_4439-480 aa

PF13855.13LRR_8440-496 aa

PF12799.14LRR_4465-501 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030117	`PF13855.13`	LRR_8	396	451	5.6e-18	65.2
LXL04_030117	`PF14580.13`	LRR_9	400	504	4e-10	40.3
LXL04_030117	`PF12799.14`	LRR_4	419	454	6.7e-20	71.4
LXL04_030117	`PF12799.14`	LRR_4	439	480	6.7e-20	71.4
LXL04_030117	`PF13855.13`	LRR_8	440	496	5.6e-18	65.2
LXL04_030117	`PF12799.14`	LRR_4	465	501	6.7e-20	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card