LXL04_030105 | RubberDandelionOmics

Gene overview

LXL04_030105

Reference: OH-1004 Chr: Chr06 Coordinates: 108251814-108253173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1206 bp · LXL04_030105|LXL04_030105|OH1004|cDNA

ATGGATCCTCTAACGGCTCTCCGGGAGATGACGATGAGAAACGAGCTCGACAAAATCGTCCGATTTGACAACGAGTACCGATTCGGCTCCTCCTACTCGTTCCCCTGCACTATCGAAACGGCCTACAGATCAAAACAAGGTTATCTCTACACCCTCGAAACCCTAGTTTACTTCATTAAGAATGTCAACATCAAGCACCACGATTACATTCGTAACGCCGGCACACAGAAGATTCCTGCGGTCACTCTCCTCGATCGCAA...

CDS

Download CDS FASTA

1206 bp · LXL04_030105|LXL04_030105|OH1004|CDS

ATGGATCCTCTAACGGCTCTCCGGGAGATGACGATGAGAAACGAGCTCGACAAAATCGTCCGATTTGACAACGAGTACCGATTCGGCTCCTCCTACTCGTTCCCCTGCACTATCGAAACGGCCTACAGATCAAAACAAGGTTATCTCTACACCCTCGAAACCCTAGTTTACTTCATTAAGAATGTCAACATCAAGCACCACGATTACATTCGTAACGCCGGCACACAGAAGATTCCTGCGGTCACTCTCCTCGATCGCAA...

Protein

Download Protein FASTA

401 aa · LXL04_030105|LXL04_030105|OH1004|PROTEIN

MDPLTALREMTMRNELDKIVRFDNEYRFGSSYSFPCTIETAYRSKQGYLYTLETLVYFIKNVNIKHHDYIRNAGTQKIPAVTLLDRKPLIEYLQGRISSTDAIEFLPPPPQHQSFEHHDYRIGDYPNLNLVPGDELDVDNQEPKVAVIENPMDLLRSIERPLKDRETILECRHRDFYSVLTAATKRDEERQRLESQQRKDGLVAKNRIDRGFGDDLGLGLDGTPRPKMHMKGSKIGDGVPIILVPSASQTLITIYNVKEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030105`
TK1151 ID	TkA07G375370
OH-1004 ID	LXL04_030105
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030105

Location Chr06:108251814-108253173 (-)

Description Similar to CDC73: Protein CDC73 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22590`	Component of the PAF1 complex (PAF1C) which is involved in histone modifications such as methylation on histone H3 'Lys-4' (H3K4me3).	The Arabidopsis Paf1c complex component CDC73 participates in the modification of FLOWERING LOCUS C chromatin.2010 · DOI: 10.1104/pp.110.158386

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030105 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0001558 regulation of cell growth Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0030177 positive regulation of Wnt signaling pathway Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

KEGG gene cross-reference

ath:AT3G22590

gga:424356

rno:304832

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.680

Rank 1 · LXL04_030105 · OH-1004

Cytoplasm0.374

Rank 2 · LXL04_030105 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_030105 · OH-1004

Mitochondrion0.023

Rank 4 · LXL04_030105 · OH-1004

Endoplasmic reticulum0.017

Rank 5 · LXL04_030105 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16050.11CDC73_N2-104 aa

PF05179.21CDC73_C239-394 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030105	`PF16050.11`	CDC73_N	2	104	4.1e-21	76.3
LXL04_030105	`PF05179.21`	CDC73_C	239	394	9.8e-51	172.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJ87`	Arabidopsis thaliana	Protein CDC73 homolog	61.962%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card