LXL04_030091 | RubberDandelionOmics

Gene overview

LXL04_030091

Reference: OH-1004 Chr: Chr06 Coordinates: 107368280-107369251 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

972 bp · LXL04_030091|LXL04_030091|OH1004|cDNA

ATGGCCTTTACTGCCATGGATTTGTGGAACAACAATGACTTTCAGCAATCGACAGCTGGTGGTGAATTGATGGAGGCACTTGAACCTTTTTATAAAAGTGCCTCATCTTCTTATTCTCAAATGACTACTTctaattaccaaaatacccttccATTCTCTACTTCTTCTACCTCTTATCCCTACCCTTCATCGTCTTTCGACTCTTttccttcatcttcttcctATAACGCCACCAACCTCCAACAAACCGGTTTCAAACC...

CDS

Download CDS FASTA

972 bp · LXL04_030091|LXL04_030091|OH1004|CDS

ATGGCCTTTACTGCCATGGATTTGTGGAACAACAATGACTTTCAGCAATCGACAGCTGGTGGTGAATTGATGGAGGCACTTGAACCTTTTTATAAAAGTGCCTCATCTTCTTATTCTCAAATGACTACTTCTAATTACCAAAATACCCTTCCATTCTCTACTTCTTCTACCTCTTATCCCTACCCTTCATCGTCTTTCGACTCTTTTCCTTCATCTTCTTCCTATAACGCCACCAACCTCCAACAAACCGGTTTCAAACC...

Protein

Download Protein FASTA

323 aa · LXL04_030091|LXL04_030091|OH1004|PROTEIN

MAFTAMDLWNNNDFQQSTAGGELMEALEPFYKSASSSYSQMTTSNYQNTLPFSTSSTSYPYPSSSFDSFPSSSSYNATNLQQTGFKPDYSIQDRFVYDQPGSSVGLNQLPESQIYQIQTQMELQIPPQWPQNNLNFMEPDPVPMKQTGSPPKPPKLYRGVRQRHWGKWVAEIRLPKSRTRLWLGTFNSAEEAALAYDKAAYKLRGDYARLNFPHLRLNGSHATDFKPLHSSVVAKLQTICQCLAEGKSVDGTKKAGSRRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030091`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030091

Location Chr06:107368280-107369251 (+)

Description Similar to RAP2-4: Ethylene-responsive transcription factor RAP2-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78080`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g22190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g36060`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g39780`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g65130`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030091 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009415 response to water Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G22190

ath:AT1G36060

ath:AT1G78080

ath:AT4G39780

ath:AT5G65130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_030091 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_030091 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_030091 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_030091 · OH-1004

Plastid0.015

Rank 5 · LXL04_030091 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP2156-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030091	`PF00847.27`	AP2	156	205	6.4e-14	52.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1E4`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-4	47.443%	Swiss-Prot	moderate database homology
`Q9LM15`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-13	54.455%	Swiss-Prot	moderate database homology
`Q9SKW5`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF055	45.342%	Swiss-Prot	moderate database homology
`O65665`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF060	46.725%	Swiss-Prot	moderate database homology
`Q9FJQ2`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF057	45.133%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card