LXL04_030087 | RubberDandelionOmics

Gene overview

LXL04_030087

Reference: OH-1004 Chr: Chr06 Coordinates: 107223995-107234400 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · LXL04_030087|LXL04_030087|OH1004|cDNA

ATGGATTTTCCTGTGTTGCAACCACTGTTCAAGAACTCCTCGCTGGAGAAGATGACCAAAACTTTATCGGAAATATGGCCGGCCCACTCCCCCAACTCCTCCATTTTGCTAAATCCTCATTTTCTCTCTTCAATTCCAGACTCTTCTTTCCATCTCTTTCACATACATTTCTTCACTTTGGTTTCCGATCGGACTTTTCCATCAACCTTAGCCGGATTTTTTCTACCGCCGGTGGCTGATCTCATCTGTTACTTACCGGA...

CDS

Download CDS FASTA

1632 bp · LXL04_030087|LXL04_030087|OH1004|CDS

ATGGATTTTCCTGTGTTGCAACCACTGTTCAAGAACTCCTCGCTGGAGAAGATGACCAAAACTTTATCGGAAATATGGCCGGCCCACTCCCCCAACTCCTCCATTTTGCTAAATCCTCATTTTCTCTCTTCAATTCCAGACTCTTCTTTCCATCTCTTTCACATACATTTCTTCACTTTGGTTTCCGATCGGACTTTTCCATCAACCTTAGCCGGATTTTTTCTACCGCCGGTGGCTGATCTCATCTGTTACTTACCGGA...

Protein

Download Protein FASTA

543 aa · LXL04_030087|LXL04_030087|OH1004|PROTEIN

MDFPVLQPLFKNSSLEKMTKTLSEIWPAHSPNSSILLNPHFLSSIPDSSFHLFHIHFFTLVSDRTFPSTLAGFFLPPVADLICYLPDNMAQFQNQELEYIIDDEYYDMTDFADSPFRDNNNNSQTSCAEDSMDSDFEDDFDQSKPKTDTSAEEARNGKDIQGIPWERLNFTRDKYRETRLKQYKNYENLPHSREHLEKECKKVDKNQILYDFQFNTRLVKPTVVHFQLRNLLWATSKHDLYLMQNYSVMHWSSLLKRGKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030087`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_030087`
Location	Chr06:107223995-107234400 (+)
Description	Similar to SPBC2A9.03: Uncharacterized WD repeat-containing protein C2A9.03 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030087` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006282 regulation of DNA repair Biological Process GO:0006352 DNA-templated transcription initiation Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0042789 mRNA transcription by RNA polymerase II Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005669 transcription factor TFIID complex Cellular Component
KEGG gene cross-reference	ana:alr2800 mmu:226182 spo:2540276 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.555

Rank 1 · LXL04_030087 · OH-1004

Nucleus0.498

Rank 2 · LXL04_030087 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_030087 · OH-1004

Lysosome / Vacuole0.051

Rank 4 · LXL04_030087 · OH-1004

Cell membrane0.045

Rank 5 · LXL04_030087 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24814.2WD40_Prp19290-484 aa

PF25174.2Beta-prop_THOC3331-513 aa

PF25175.2Beta-prop_WDR5344-520 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd344-475 aa

PF25391.2WD40_Gbeta344-479 aa

PF24817.2WD40_WDHD1_1st344-445 aa

PF23414.2Beta-prop_EML_2345-488 aa

PF23381.2Beta-prop_IFT122_1st373-521 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030087	`PF24814.2`	WD40_Prp19	290	484	3.1e-19	69.8
LXL04_030087	`PF25174.2`	Beta-prop_THOC3	331	513	1.6e-23	83.8
LXL04_030087	`PF25175.2`	Beta-prop_WDR5	344	520	1.4e-19	71.2
LXL04_030087	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	344	475	2.2e-10	41.0
LXL04_030087	`PF25391.2`	WD40_Gbeta	344	479	1.1e-08	35.2
LXL04_030087	`PF24817.2`	WD40_WDHD1_1st	344	445	2.2e-07	31.1
LXL04_030087	`PF23414.2`	Beta-prop_EML_2	345	488	1.5e-13	51.4
LXL04_030087	`PF23381.2`	Beta-prop_IFT122_1st	373	521	1.6e-15	57.9
LXL04_030087	`PF25173.2`	Beta-prop_WDR3_1st	374	521	6.3e-12	46.3
LXL04_030087	`PF24796.2`	WDR55	377	487	4.1e-09	36.6
LXL04_030087	`PF24807.2`	WD40_CDC20-Fz	378	489	1.6e-12	48.0
LXL04_030087	`PF26550.2`	Tricorn_2nd	378	478	6.8e-06	25.7
LXL04_030087	`PF24805.2`	EIF3I	400	473	6.6e-09	36.1
LXL04_030087	`PF00400.39`	WD40	403	441	8.9e-14	52.0
LXL04_030087	`PF23393.3`	Beta-prop_WDR90_POC16_2nd	412	484	2e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card