LXL04_029830 | RubberDandelionOmics

Gene overview

LXL04_029830

Reference: OH-1004 Chr: Chr06 Coordinates: 101369244-101370613 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

627 bp · LXL04_029830|LXL04_029830|OH1004|cDNA

ATGTCAAAATACCTCCCTTTCTCTTGTAGTGACTACCTGTTCAAGCTACTACTCATAGGAGATTCAGGAGTTGGAAAATCATGTCTGCTGTTGCGTTTTGCAGATGATTCATACTTGGAAAGTTACATCAGCACCATCGGTGTAGACTTTAAAATCCGCACAGTGGAACAGGATGGCAAAACAATTAAGCTCCAAATTTGGGACACTGCTGGCCAAGAACGTTTCAGGACAATCACCAGCAGCTACTATCGTGGAGCTCA...

CDS

Download CDS FASTA

627 bp · LXL04_029830|LXL04_029830|OH1004|CDS

ATGTCAAAATACCTCCCTTTCTCTTGTAGTGACTACCTGTTCAAGCTACTACTCATAGGAGATTCAGGAGTTGGAAAATCATGTCTGCTGTTGCGTTTTGCAGATGATTCATACTTGGAAAGTTACATCAGCACCATCGGTGTAGACTTTAAAATCCGCACAGTGGAACAGGATGGCAAAACAATTAAGCTCCAAATTTGGGACACTGCTGGCCAAGAACGTTTCAGGACAATCACCAGCAGCTACTATCGTGGAGCTCA...

Protein

Download Protein FASTA

208 aa · LXL04_029830|LXL04_029830|OH1004|PROTEIN

MSKYLPFSCSDYLFKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLSEIDRYANENVNKLLVGNKCDLTSQKVVSYETGKAFADEIGIPFLETSAKSSTNVEEAFMAMTAEIKNRMASQPSMNNARPPTVQIRGQPVNQKSGCCSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029830`
TK1151 ID	TkA07G351010
OH-1004 ID	LXL04_029830
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.537 / OH-1004 95.192 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029830

Location Chr06:101369244-101370613 (-)

Description Similar to RABD2C: Ras-related protein RABD2c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17530`	Protein transport.	No verified direct reference in this release
`At5g47200`	Protein transport.	No verified direct reference in this release
`At1g02130`	Protein transport.	A rab1 GTPase is required for transport between the endoplasmic reticulum and golgi apparatus and for normal golgi movement in plants.2000 · DOI: 10.1105/tpc.12.11.2201 Redistribution of membrane proteins between the Golgi apparatus and endoplasmic reticulum in plants is reversible and not dependent on cytoskeletal networks.2002 · DOI: 10.1046/j.0960-7412.2002.01252.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0558600`	Possesses GTPase activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029830 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G02130

ath:AT4G17530

ath:AT5G47200

dosa:Os01g0558600

zma:542396

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512

Rank 1 · LXL04_029830 · OH-1004

Golgi apparatus0.430

Rank 2 · LXL04_029830 · OH-1004

Lysosome / Vacuole0.183

Rank 3 · LXL04_029830 · OH-1004

Cell membrane0.162

Rank 4 · LXL04_029830 · OH-1004

Endoplasmic reticulum0.132

Rank 5 · LXL04_029830 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf14-134 aa

PF00071.29Ras15-175 aa

PF08477.20Roc15-129 aa

PF00009.34GTP_EFTU50-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029830	`PF00025.28`	Arf	14	134	5.3e-17	62.6
LXL04_029830	`PF00071.29`	Ras	15	175	2e-69	233.1
LXL04_029830	`PF08477.20`	Roc	15	129	3.1e-37	128.1
LXL04_029830	`PF00009.34`	GTP_EFTU	50	172	2e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEH3`	Arabidopsis thaliana	Ras-related protein RABD2c	90.404%	Swiss-Prot	strong database homology
`Q9FPJ4`	Arabidopsis thaliana	Ras-related protein RABD2b	90.404%	Swiss-Prot	strong database homology
`P28188`	Arabidopsis thaliana	Ras-related protein RABD2a	86.869%	Swiss-Prot	strong database homology
`P40392`	Oryza sativa subsp. japonica	Ras-related protein RIC1	87.817%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card