LXL04_029795 | RubberDandelionOmics

Gene overview

LXL04_029795

Reference: OH-1004 Chr: Chr06 Coordinates: 100544148-100545169 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · LXL04_029795|LXL04_029795|OH1004|cDNA

ATGGATGGCGACGACCTACGAATAAAACCTAGCTCGGTTGCTGATGGGTTGCGGCTCCTAAAACGAACCGAAGATGAGAGATACACAGAAGATAAGATGAAGATCGACGGTGGTGTGTCCGACGGGAATAGGAGGTGCGAAGACCTGGGGAGCTTCGGTGGGCAGTGGCTATCGGAGAAACTTAGCTTTCCGGTTGGTGGATTCCTCATATCCGGTGCTGCTAGGCCTAATTTCCAGGTGGTGGATGCTCTTGGAACAGA...

CDS

Download CDS FASTA

480 bp · LXL04_029795|LXL04_029795|OH1004|CDS

ATGGATGGCGACGACCTACGAATAAAACCTAGCTCGGTTGCTGATGGGTTGCGGCTCCTAAAACGAACCGAAGATGAGAGATACACAGAAGATAAGATGAAGATCGACGGTGGTGTGTCCGACGGGAATAGGAGGTGCGAAGACCTGGGGAGCTTCGGTGGGCAGTGGCTATCGGAGAAACTTAGCTTTCCGGTTGGTGGATTCCTCATATCCGGTGCTGCTAGGCCTAATTTCCAGGTGGTGGATGCTCTTGGAACAGA...

Protein

Download Protein FASTA

159 aa · LXL04_029795|LXL04_029795|OH1004|PROTEIN

MDGDDLRIKPSSVADGLRLLKRTEDERYTEDKMKIDGGVSDGNRRCEDLGSFGGQWLSEKLSFPVGGFLISGAARPNFQVVDALGTDYFEHLLPDIIQNCSHQRSLVRDGYLTLFKYLSRSLGVKFQNYLQQVLPAILDGKTSATSRASTTAFPLHVSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029795`
TK1151 ID	TkA07G347850
OH-1004 ID	LXL04_029795
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 79.874 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029795

Location Chr06:100544148-100545169 (-)

Description Similar to ILA: Protein ILITYHIA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64790`	Involved in immunity against bacterial infection and in non-host resistance.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029795 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006414 translational elongation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process

GO:0034198 cellular response to amino acid starvation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0072344 rescue of stalled cytosolic ribosome Biological Process

GO:0085020 protein K6-linked ubiquitination Biological Process

GO:0140469 GCN2-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT1G64790

hsa:10985

mmu:231659

spo:2542235

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.467

Rank 1 · LXL04_029795 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_029795 · OH-1004

Mitochondrion0.094

Rank 3 · LXL04_029795 · OH-1004

Cell membrane0.076

Rank 4 · LXL04_029795 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_029795 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I893`	Arabidopsis thaliana	Protein ILITYHIA	61.176%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card