LXL04_029726 | RubberDandelionOmics

Gene overview

LXL04_029726

Reference: OH-1004 Chr: Chr06 Coordinates: 98643869-98646099 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · LXL04_029726|LXL04_029726|OH1004|cDNA

ATGGCAACAGCTGCTTCACTCCACACTGCTTCACTCTCCTCTTCTTCCACTCTTCTTCAGGTAATGCACAACATATTTTCAACAAATTCTTCGCATTTACTTCAAATTTACCTGATGATCATTCACCAGCTGGACCGAAGATCAAGACTCCCTGTTCGATCTCTATTGCCGATCGCCGCGTTCAAATCTAGCAAATCATGCACTCCAATTCGAGCCTCCTTCACTGATTTCTCTGCTTCTCCCGACACCGGTGGAAGGAC...

CDS

Download CDS FASTA

1269 bp · LXL04_029726|LXL04_029726|OH1004|CDS

ATGGCAACAGCTGCTTCACTCCACACTGCTTCACTCTCCTCTTCTTCCACTCTTCTTCAGGTAATGCACAACATATTTTCAACAAATTCTTCGCATTTACTTCAAATTTACCTGATGATCATTCACCAGCTGGACCGAAGATCAAGACTCCCTGTTCGATCTCTATTGCCGATCGCCGCGTTCAAATCTAGCAAATCATGCACTCCAATTCGAGCCTCCTTCACTGATTTCTCTGCTTCTCCCGACACCGGTGGAAGGAC...

Protein

Download Protein FASTA

422 aa · LXL04_029726|LXL04_029726|OH1004|PROTEIN

MATAASLHTASLSSSSTLLQVMHNIFSTNSSHLLQIYLMIIHQLDRRSRLPVRSLLPIAAFKSSKSCTPIRASFTDFSASPDTGGRTELDALSRFSEVVPDTVVFDDFERFPPTAATVSSSLLLGICSLPDTTFKGAVDTALADKQCYGLGSLEDRMTCFVNKALVNVGGELSKLVPGRVSTEVDARLAYDTHAIVGKVESLLHLYNSIDVPAERLLFKIPATWQGIEAARLLESEGIQTHMTFVYSFCQAAAAAQAGAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029726`
TK1151 ID	TkA07G341890
OH-1004 ID	LXL04_029726
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_029726`
Location	Chr06:98643869-98646099 (-)
Description	Similar to tal: Transaldolase (Histophilus somni (strain 2336)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029726` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006098 pentose-phosphate shunt Biological Process GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0004801 transaldolase activity Molecular Function
KEGG gene cross-reference	bta:513453 hin:HI_1125 hip:CGSHiEE_06420 hsm:HSM_0072 hso:HS_0204 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_029726 · OH-1004

Mitochondrion0.041

Rank 2 · LXL04_029726 · OH-1004

Cytoplasm0.026

Rank 3 · LXL04_029726 · OH-1004

Nucleus0.021

Rank 4 · LXL04_029726 · OH-1004

Peroxisome0.021

Rank 5 · LXL04_029726 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00923.26TAL_FSA135-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029726	`PF00923.26`	TAL_FSA	135	359	1.6e-47	163.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card