LXL04_029701 | RubberDandelionOmics

Gene overview

LXL04_029701

Reference: OH-1004 Chr: Chr06 Coordinates: 97447519-97448013 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · LXL04_029701|LXL04_029701|OH1004|cDNA

ATGGGTTCCGACGCCAACAAGATGAACGACGGTACGAGTTTCCAGCCGTCCGAACCGGCGCCGTGCGCCAACGGTTGCGGCTTTTTCGGGTCCGCCGCCACCATGAATCTCTGCTCCAAGTGCTTTCGTGACAACCGGATCAAGGAGGAGCAAGCCGCCTCAGCCAAAGCCGCCGTCGATAAGCTCGTCAACAACGTCGTAACCTTCCCGTCACAAATTCCCTCTTCCTCGTCTTCCTCTTCCGGATCTGAACCTCTTCC...

CDS

Download CDS FASTA

495 bp · LXL04_029701|LXL04_029701|OH1004|CDS

ATGGGTTCCGACGCCAACAAGATGAACGACGGTACGAGTTTCCAGCCGTCCGAACCGGCGCCGTGCGCCAACGGTTGCGGCTTTTTCGGGTCCGCCGCCACCATGAATCTCTGCTCCAAGTGCTTTCGTGACAACCGGATCAAGGAGGAGCAAGCCGCCTCAGCCAAAGCCGCCGTCGATAAGCTCGTCAACAACGTCGTAACCTTCCCGTCACAAATTCCCTCTTCCTCGTCTTCCTCTTCCGGATCTGAACCTCTTCC...

Protein

Download Protein FASTA

164 aa · LXL04_029701|LXL04_029701|OH1004|PROTEIN

MGSDANKMNDGTSFQPSEPAPCANGCGFFGSAATMNLCSKCFRDNRIKEEQAASAKAAVDKLVNNVVTFPSQIPSSSSSSSGSEPLPPPPTVAAVEVKEKIRNRCLTCNKKVGVMGFICKCGDTFCGSHRYPEKHDCEFDFKKTGKAAIAKQNPVIKADKVDRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029701`
TK1151 ID	TkA07G337570
OH-1004 ID	LXL04_029701
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029701

Location Chr06:97447519-97448013 (+)

Description Similar to SAP1: Zinc finger A20 and AN1 domain-containing stress-associated protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12440`	May be involved in environmental stress response.	No verified direct reference in this release
`At4g12040`	May be involved in environmental stress response.	No verified direct reference in this release
`At4g22820`	May be involved in environmental stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0195600`	May be involved in environmental stress response.	No verified direct reference in this release
`Os06g0612800`	May be involved in environmental stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029701 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12440

ath:AT4G12040

ath:AT4G22820

dosa:Os02g0195600

dosa:Os06g0612800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.759

Rank 1 · LXL04_029701 · OH-1004

Cytoplasm0.337

Rank 2 · LXL04_029701 · OH-1004

Mitochondrion0.036

Rank 3 · LXL04_029701 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_029701 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_029701 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01754.24zf-A2021-46 aa

PF01428.24zf-AN1107-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029701	`PF01754.24`	zf-A20	21	46	6.2e-15	55.2
LXL04_029701	`PF01428.24`	zf-AN1	107	141	1.5e-10	41.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NNI8`	Arabidopsis thaliana	Zinc finger A20 and AN1 domain-containing stress-associated protein 1	53.333%	Swiss-Prot	strong database homology
`Q9SZ69`	Arabidopsis thaliana	Zinc finger A20 and AN1 domain-containing stress-associated protein 7	52.247%	Swiss-Prot	strong database homology
`O49663`	Arabidopsis thaliana	Zinc finger A20 and AN1 domain-containing stress-associated protein 9	48.128%	Swiss-Prot	moderate database homology
`Q6H7P8`	Oryza sativa subsp. japonica	Zinc finger A20 and AN1 domain-containing stress-associated protein 4	43.293%	Swiss-Prot	moderate database homology
`A3BDI8`	Oryza sativa subsp. japonica	Zinc finger A20 and AN1 domain-containing stress-associated protein 8	41.714%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card