LXL04_029688 | RubberDandelionOmics

Gene overview

LXL04_029688

Reference: OH-1004 Chr: Chr06 Coordinates: 97102759-97108489 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2661 bp · LXL04_029688|LXL04_029688|OH1004|cDNA

ATGGTGGAACTTCCGACCCGAATTGGGATTCTTCCGTTCAGGAACAAAGTTTTGTTGCCTGGCGCAATCATCCGAATTCAATGCACTTCTCCGAGCAGTGTGAAATTGGTGGAACAAGAATTATGGCAGAGGGAGGAGAAAGGGTTGATTGGCATTCTGCCTGTTCGAGATATTGCCGAGGGTTCCATAGTGACACAAGGAGCTGATTTGGGTGATAAAAGCTCCAAGAATCAACAAGTCAAATCAGATTCTCACAAACT...

CDS

Download CDS FASTA

2661 bp · LXL04_029688|LXL04_029688|OH1004|CDS

ATGGTGGAACTTCCGACCCGAATTGGGATTCTTCCGTTCAGGAACAAAGTTTTGTTGCCTGGCGCAATCATCCGAATTCAATGCACTTCTCCGAGCAGTGTGAAATTGGTGGAACAAGAATTATGGCAGAGGGAGGAGAAAGGGTTGATTGGCATTCTGCCTGTTCGAGATATTGCCGAGGGTTCCATAGTGACACAAGGAGCTGATTTGGGTGATAAAAGCTCCAAGAATCAACAAGTCAAATCAGATTCTCACAAACT...

Protein

Download Protein FASTA

886 aa · LXL04_029688|LXL04_029688|OH1004|PROTEIN

MVELPTRIGILPFRNKVLLPGAIIRIQCTSPSSVKLVEQELWQREEKGLIGILPVRDIAEGSIVTQGADLGDKSSKNQQVKSDSHKLDGKNQQEPNWHTRGVAARALHLSRGVEKPSGRVTYIVVLEGLSRFSVEELNTRGTYTTARISPLDMTKTEMEQIEQDADFIALSRQFKLTAMELITALEQKQKTGGRTKVLLETVPVHKLADIFVASFEISFEEQLAMLDSVDVKVRLSKATELVDRHLQSIRVAEKITQKVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029688`
TK1151 ID	TkA07G336580
OH-1004 ID	LXL04_029688
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029688

Location Chr06:97102759-97108489 (-)

Description Similar to Lon protease homolog 2, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47040`	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix (By similarity).	Arabidopsis LON2 is necessary for peroxisomal function and sustained matrix protein import.2009 · DOI: 10.1104/pp.109.142505

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BDV1`	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix.	No verified direct reference in this release
`Os09g0533400`	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029688 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0006625 protein targeting to peroxisome Biological Process

GO:0009408 response to heat Biological Process

GO:0016485 protein processing Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016560 protein import into peroxisome matrix, docking Biological Process

GO:0032042 mitochondrial DNA metabolic process Biological Process

GO:0048527 lateral root development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005782 peroxisomal matrix Cellular Component

GO:0070013 intracellular organelle lumen Cellular Component

KEGG gene cross-reference

ath:AT5G47040

dosa:Os09g0533400

zma:732820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.466

Rank 1 · LXL04_029688 · OH-1004

Cytoplasm0.255

Rank 2 · LXL04_029688 · OH-1004

Mitochondrion0.194

Rank 3 · LXL04_029688 · OH-1004

Nucleus0.119

Rank 4 · LXL04_029688 · OH-1004

Endoplasmic reticulum0.059

Rank 5 · LXL04_029688 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02190.23LON_substr_bdg10-244 aa

PF00004.36AAA395-535 aa

PF07728.21AAA_5395-532 aa

PF22667.3Lon_lid560-611 aa

PF05362.20Lon_C668-875 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029688	`PF02190.23`	LON_substr_bdg	10	244	2.4e-28	100.1
LXL04_029688	`PF00004.36`	AAA	395	535	3.3e-25	89.8
LXL04_029688	`PF07728.21`	AAA_5	395	532	2.5e-08	34.7
LXL04_029688	`PF22667.3`	Lon_lid	560	611	1.6e-17	63.6
LXL04_029688	`PF05362.20`	Lon_C	668	875	4.4e-76	255.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64948`	Arabidopsis thaliana	Lon protease homolog 2, peroxisomal	79.007%	Swiss-Prot	strong database homology
`B8BDV1`	Oryza sativa subsp. indica	Lon protease homolog 2, peroxisomal	78.387%	Swiss-Prot	strong database homology
`Q0J032`	Oryza sativa subsp. japonica	Lon protease homolog 2, peroxisomal	78.315%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card