LXL04_029660 | RubberDandelionOmics

Gene overview

LXL04_029660

Reference: OH-1004 Chr: Chr06 Coordinates: 96635756-96636085 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · LXL04_029660|LXL04_029660|OH1004|cDNA

TTGGACTTCAAATGCCACAAAGATGACATGCAAAGACTAGAACAAGAACTCTCACGGGCCAAATCTCTGACCGACCCGGATAATGACTTGACTATTGGGAAACGACTTCATGGGTCTgctgatgaagatgatgatgatgatgatgatgaagctgaTGCGGTTGACCATGAATGTGTAATGTGTCAAGAAAATGAAGTTTCAGTTCTTTTCTTGCCATGTGCACACGAAGTAGTTTGTGTGGGTTGCAATGAGGAGCTTAA...

CDS

Download CDS FASTA

330 bp · LXL04_029660|LXL04_029660|OH1004|CDS

TTGGACTTCAAATGCCACAAAGATGACATGCAAAGACTAGAACAAGAACTCTCACGGGCCAAATCTCTGACCGACCCGGATAATGACTTGACTATTGGGAAACGACTTCATGGGTCTGCTGATGAAGATGATGATGATGATGATGATGAAGCTGATGCGGTTGACCATGAATGTGTAATGTGTCAAGAAAATGAAGTTTCAGTTCTTTTCTTGCCATGTGCACACGAAGTAGTTTGTGTGGGTTGCAATGAGGAGCTTAA...

Protein

Download Protein FASTA

109 aa · LXL04_029660|LXL04_029660|OH1004|PROTEIN

MDFKCHKDDMQRLEQELSRAKSLTDPDNDLTIGKRLHGSADEDDDDDDDEADAVDHECVMCQENEVSVLFLPCAHEVVCVGCNEELKKDECPSCGEAIEQRIRVFGGSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029660`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029660

Location Chr06:96635756-96636085 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32530`	MND1-interacting protein 1.	No verified direct reference in this release
`At1g03365`	Putative E3 ubiquitin-protein ligase RF4.	No verified direct reference in this release
`At4g03000`	Putative E3 ubiquitin-protein ligase RF298.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029660 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0007249 canonical NF-kappaB signal transduction Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031398 positive regulation of protein ubiquitination Biological Process

GO:0033209 tumor necrosis factor-mediated signaling pathway Biological Process

GO:0034121 regulation of toll-like receptor signaling pathway Biological Process

GO:0038061 non-canonical NF-kappaB signal transduction Biological Process

GO:0039535 regulation of RIG-I signaling pathway Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0060544 regulation of necroptotic process Biological Process

KEGG gene cross-reference

ath:AT1G03365

ath:AT1G32530

ath:AT4G03000

hsa:330

mmu:240396

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.647

Rank 1 · LXL04_029660 · OH-1004

Cytoplasm0.351

Rank 2 · LXL04_029660 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_029660 · OH-1004

Lysosome / Vacuole0.044

Rank 4 · LXL04_029660 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_029660 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920.13zf-C3HC4_355-100 aa

PF14447.13Prok-RING_458-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029660	`PF13920.13`	zf-C3HC4_3	55	100	2e-13	50.6
LXL04_029660	`PF14447.13`	Prok-RING_4	58	101	5e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RX22`	Arabidopsis thaliana	MND1-interacting protein 1	40.310%	Swiss-Prot	moderate database homology
`Q9ZVT8`	Arabidopsis thaliana	Putative E3 ubiquitin-protein ligase RF4	35.849%	Swiss-Prot	moderate database homology
`Q0WPJ7`	Arabidopsis thaliana	Putative E3 ubiquitin-protein ligase RF298	29.921%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card