LXL04_029633 | RubberDandelionOmics

Gene overview

LXL04_029633

Reference: OH-1004 Chr: Chr06 Coordinates: 96050074-96054506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2064 bp · LXL04_029633|LXL04_029633|OH1004|cDNA

ATGAACCGATCGATTCCATTAAGACTTTTCTTGATTACTTTCGGACTGTTTCTAGCTACTGCCGATGCTAGTCAACCAATCGAAGTTCATGCTCTCGCAATGTTTAAAGAAGCCATATTTGATGACCCATCGTCGGCTTTAGCAAGCTGGAACGTTCTAGATTCAGATCCTTGCAACTGGGCTGGTGTTTCTTGTTCCGGAAGTCAAGTCACAAAGCTGAACATTTCTCGGTCATCTATAAAGGGGTTTATTGCTCGTGA...

CDS

Download CDS FASTA

2064 bp · LXL04_029633|LXL04_029633|OH1004|CDS

ATGAACCGATCGATTCCATTAAGACTTTTCTTGATTACTTTCGGACTGTTTCTAGCTACTGCCGATGCTAGTCAACCAATCGAAGTTCATGCTCTCGCAATGTTTAAAGAAGCCATATTTGATGACCCATCGTCGGCTTTAGCAAGCTGGAACGTTCTAGATTCAGATCCTTGCAACTGGGCTGGTGTTTCTTGTTCCGGAAGTCAAGTCACAAAGCTGAACATTTCTCGGTCATCTATAAAGGGGTTTATTGCTCGTGA...

Protein

Download Protein FASTA

687 aa · LXL04_029633|LXL04_029633|OH1004|PROTEIN

MNRSIPLRLFLITFGLFLATADASQPIEVHALAMFKEAIFDDPSSALASWNVLDSDPCNWAGVSCSGSQVTKLNISRSSIKGFIARELFQLSALQELILHGNKLIGSIPKEIGSLKKLKVLDLGMNQISGPIPHEIGNLVSIVKINLQSNGLTGQLPSELGNLKYLEELRLDRNKLRGSVPGGNASAIVSNTQGMFASNVTRLGFCSSDSLKVADFSYNFLIGSIPKCLGYLPRTSFQGNCLPIKDIKQRTSQQCGSPPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029633`
TK1151 ID	TkA07G332310
OH-1004 ID	LXL04_029633
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 99.564 / OH-1004 70.597 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029633

Location Chr06:96050074-96054506 (+)

Description Similar to At1g63430: Probable LRR receptor-like serine/threonine-protein kinase At1g63430

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63430`	Probable LRR receptor-like serine/threonine-protein kinase At1g63430.	No verified direct reference in this release
`At4g18640`	Involved in the pollen tube perception of the female signal by binding an unidentified female attractant.	Analysis of the root-hair morphogenesis transcriptome reveals the molecular identity of six genes with roles in root-hair development in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02609.x
`At5g45840`	Involved in the pollen tube perception of the female signal.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At1g31420`	Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).	Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354
`At2g40270`	Inactive receptor-like serine/threonine-protein kinase At2g40270.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029633 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G63430

ath:AT4G18640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.847

Rank 1 · LXL04_029633 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_029633 · OH-1004

Nucleus0.071

Rank 3 · LXL04_029633 · OH-1004

Endoplasmic reticulum0.070

Rank 4 · LXL04_029633 · OH-1004

Plastid0.022

Rank 5 · LXL04_029633 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_228-66 aa

PF23598.2LRR_1482-172 aa

PF12799.14LRR_493-129 aa

PF13855.13LRR_8113-152 aa

PF07714.24PK_Tyr_Ser-Thr392-657 aa

PF00069.32Pkinase393-657 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029633	`PF08263.18`	LRRNT_2	28	66	2.4e-12	47.6
LXL04_029633	`PF23598.2`	LRR_14	82	172	1.7e-09	37.6
LXL04_029633	`PF12799.14`	LRR_4	93	129	3.5e-10	40.5
LXL04_029633	`PF13855.13`	LRR_8	113	152	1.3e-12	48.0
LXL04_029633	`PF07714.24`	PK_Tyr_Ser-Thr	392	657	1.8e-16	61.0
LXL04_029633	`PF00069.32`	Pkinase	393	657	4.1e-14	53.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGH8`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g63430	59.243%	Swiss-Prot	strong database homology
`C0LGQ4`	Arabidopsis thaliana	Protein MALE DISCOVERER 2	37.530%	Swiss-Prot	moderate database homology
`C0LGU7`	Arabidopsis thaliana	Protein MALE DISCOVERER 1	35.452%	Swiss-Prot	moderate database homology
`C0LGF4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FEI 1	27.602%	Swiss-Prot	weak database homology
`Q9SIZ4`	Arabidopsis thaliana	Inactive receptor-like serine/threonine-protein kinase At2g40270	36.893%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card