LXL04_029409 | RubberDandelionOmics

Gene overview

LXL04_029409

Reference: OH-1004 Chr: Chr06 Coordinates: 89326980-89332866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · LXL04_029409|LXL04_029409|OH1004|cDNA

ATGGAGTTCTTTCCTGCACAACCTGACCTATCTCTGCGAATCAGTCCACCAAACACCCAACCCACCTCAATAACTTGGAGAGCATCAAATCCAACTGTTCAAGATCATGATCTGGATTTGGATCATTTCTGGAAGACAGCTTTAAAGTCCCAAAACCACCATAGTTCAAGATCCAACTCCTCTTTCGGACCCTATGAACCTTACCCAACCAATTCTAACGATGCCCACCTGACCCAGAACACAACCACGACAAATCTTTA...

CDS

Download CDS FASTA

1035 bp · LXL04_029409|LXL04_029409|OH1004|CDS

ATGGAGTTCTTTCCTGCACAACCTGACCTATCTCTGCGAATCAGTCCACCAAACACCCAACCCACCTCAATAACTTGGAGAGCATCAAATCCAACTGTTCAAGATCATGATCTGGATTTGGATCATTTCTGGAAGACAGCTTTAAAGTCCCAAAACCACCATAGTTCAAGATCCAACTCCTCTTTCGGACCCTATGAACCTTACCCAACCAATTCTAACGATGCCCACCTGACCCAGAACACAACCACGACAAATCTTTA...

Protein

Download Protein FASTA

344 aa · LXL04_029409|LXL04_029409|OH1004|PROTEIN

MEFFPAQPDLSLRISPPNTQPTSITWRASNPTVQDHDLDLDHFWKTALKSQNHHSSRSNSSFGPYEPYPTNSNDAHLTQNTTTTNLYHHHQGLLKPIKGIPVLYQNSHPNVQIQAQYHHHHHQNSQPSLDSCTVATTSSSSSLTHGRSFNNIARSRLLSSRFPVKRSLRAPRMRWTTTLHSRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKTTDKALVSSAQSEVSGNGTSCDNSADIQNQRTEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029409`
TK1151 ID	TkA03G458350
OH-1004 ID	LXL04_029409
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 99.419 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029409

Location Chr06:89326980-89332866 (+)

Description Similar to KAN3: Probable transcription factor KAN3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17695`	Probable transcription factor that regulates lateral organ polarity.	No verified direct reference in this release
`At5g16560`	Transcriptional repressor that regulates lateral organ polarity.	ABERRANT TESTA SHAPE encodes a KANADI family member, linking polarity determination to separation and growth of Arabidopsis ovule integuments.2006 · DOI: 10.1111/j.1365-313x.2006.02717.x KANADI and class III HD-Zip gene families regulate embryo patterning and modulate auxin flow during embryogenesis in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047472 KANADI1 regulates adaxial-abaxial polarity in Arabidopsis by directly repressing the transcription of ASYMMETRIC LEAVES2.2008 · DOI: 10.1073/pnas.0803997105
`At5g42630`	Probable transcription factor that regulates carpel integuments formation.	ABERRANT TESTA SHAPE encodes a KANADI family member, linking polarity determination to separation and growth of Arabidopsis ovule integuments.2006 · DOI: 10.1111/j.1365-313x.2006.02717.x A new dominant Arabidopsis transparent testa mutant, sk21-D, and modulation of seed flavonoid biosynthesis by KAN4.2010 · DOI: 10.1111/j.1467-7652.2010.00525.x
`At1g14600`	Putative transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0395300`	Probable transcription factor that regulates abaxial identity during leaf development.	SHALLOT-LIKE1 is a KANADI transcription factor that modulates rice leaf rolling by regulating leaf abaxial cell development.2009 · DOI: 10.1105/tpc.108.061457

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029409 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009943 adaxial/abaxial axis specification Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010158 abaxial cell fate specification Biological Process

GO:0010229 inflorescence development Biological Process

GO:0048440 carpel development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0080060 integument development Biological Process

GO:1905392 plant organ morphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G14600

ath:AT4G17695

ath:AT5G16560

ath:AT5G42630

dosa:Os09g0395300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_029409 · OH-1004

Cytoplasm0.094

Rank 2 · LXL04_029409 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_029409 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_029409 · OH-1004

Plastid0.012

Rank 5 · LXL04_029409 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding172-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029409	`PF00249.38`	Myb_DNA-binding	172	223	7.1e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q941I2`	Arabidopsis thaliana	Probable transcription factor KAN3	37.845%	Swiss-Prot	moderate database homology
`Q93WJ9`	Arabidopsis thaliana	Transcription repressor KAN1	47.264%	Swiss-Prot	moderate database homology
`Q9FJV5`	Arabidopsis thaliana	Probable transcription factor KAN4	74.713%	Swiss-Prot	weak database homology
`Q700D9`	Arabidopsis thaliana	Putative Myb family transcription factor At1g14600	66.102%	Swiss-Prot	weak database homology
`Q0J235`	Oryza sativa subsp. japonica	Probable transcription factor RL9	46.188%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card