Gene Card
Gene overview
cDNA / CDS / Protein Sequences
486 bp · LXL04_029133|LXL04_029133|OH1004|cDNA
ATGATTCACTTTGTTCTCTTAATAAGCCGACAAGGAAAGGTTAGGCTGACTAAGTGGTATTCACCCTATTCCCAAAAGGAACGAAGTAAGGTGATAAGGGAGCTCAGTGGGATGATTCTCACACGTGGCCCAAAGCTTTGCAACTTTGTTGAATGGAGGGGATTTAAAGTCGTTTATAAGAGATATGCGAGCCTCTACTTTTGTATGTGCATTGACCAGGAAGACAACGAATTGGAGGTTCTTGAAATCATTCATCATTT...
486 bp · LXL04_029133|LXL04_029133|OH1004|CDS
ATGATTCACTTTGTTCTCTTAATAAGCCGACAAGGAAAGGTTAGGCTGACTAAGTGGTATTCACCCTATTCCCAAAAGGAACGAAGTAAGGTGATAAGGGAGCTCAGTGGGATGATTCTCACACGTGGCCCAAAGCTTTGCAACTTTGTTGAATGGAGGGGATTTAAAGTCGTTTATAAGAGATATGCGAGCCTCTACTTTTGTATGTGCATTGACCAGGAAGACAACGAATTGGAGGTTCTTGAAATCATTCATCATTT...
Protein
Download Protein FASTA161 aa · LXL04_029133|LXL04_029133|OH1004|PROTEIN
MIHFVLLISRQGKVRLTKWYSPYSQKERSKVIRELSGMILTRGPKLCNFVEWRGFKVVYKRYASLYFCMCIDQEDNELEVLEIIHHFVEILDRYFGSVCELDLIFNFHKAYYILDEILIAGELQESSKKTVARLVAAQDSLVEAVKEETYSMSHILAQATK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029133 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029133 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:81652230-81653662 (+) | |||||||||
| Description | Similar to AAP19-2: AP-1 complex subunit sigma-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0016482 cytosolic transport Biological Process GO:0060155 platelet dense granule organization Biological Process GO:0005739 mitochondrion Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005769 early endosome Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005905 clathrin-coated pit Cellular Component GO:0030121 AP-1 adaptor complex Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G17380 ath:AT4G35410 bta:616331 ddi:DDB_G0295711 mmu:108012 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01217.27Clat_adaptor_s1-140 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029133 | PF01217.27 | Clat_adaptor_s | 1 | 140 | 1.3e-56 | 191.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.