LXL04_029099 | RubberDandelionOmics

Gene overview

LXL04_029099

Reference: OH-1004 Chr: Chr06 Coordinates: 80854912-80856329 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · LXL04_029099|LXL04_029099|OH1004|cDNA

ATGGCATCATTGCCCTGTTCTTCAAATTTCATCTCCCCACTTTTTGGATCCTCGAAATCCAGTCGAACCCATCTACCTTCTTGCCTCTCCGTGTCTTCTTTTCCCACAACTACTTCCATTAAATCGTTATTAGCCTCATCAAATTCAGGGTTTTTCCAACATGGATTTGCTCTAAAAGCCGGCATTTCCTCTGGGTTTTCGTCTAATTCTCGATCTCAATTTGAGGTTTTTGCTGCAGCTACCACAGGAAAAAGCATTTA...

CDS

Download CDS FASTA

732 bp · LXL04_029099|LXL04_029099|OH1004|CDS

ATGGCATCATTGCCCTGTTCTTCAAATTTCATCTCCCCACTTTTTGGATCCTCGAAATCCAGTCGAACCCATCTACCTTCTTGCCTCTCCGTGTCTTCTTTTCCCACAACTACTTCCATTAAATCGTTATTAGCCTCATCAAATTCAGGGTTTTTCCAACATGGATTTGCTCTAAAAGCCGGCATTTCCTCTGGGTTTTCGTCTAATTCTCGATCTCAATTTGAGGTTTTTGCTGCAGCTACCACAGGAAAAAGCATTTA...

Protein

Download Protein FASTA

243 aa · LXL04_029099|LXL04_029099|OH1004|PROTEIN

MASLPCSSNFISPLFGSSKSSRTHLPSCLSVSSFPTTTSIKSLLASSNSGFFQHGFALKAGISSGFSSNSRSQFEVFAAATTGKSIYDFTVKDIDRKDVSLSKFKGKVLLIVNVASQCGLTTSNYSELSQIYNKYKDQGLEILAFPCNQFGFQEPGSNDQIKQFACTRFKAEFPIFDKVDVNGPFTAPVYQFLKSSTGGLLGDLVKWNFEKFLVDKNGKVVERYLPTTSPLQIENDIRKLVAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029099`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029099

Location Chr06:80854912-80856329 (+)

Description Similar to Phospholipid hydroperoxide glutathione peroxidase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25080`	Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.	No verified direct reference in this release
`At4g31870`	May constitute a glutathione peroxidase-like protective system against oxidative stresses.	No verified direct reference in this release
`At4g11600`	Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029099 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:1900367 positive regulation of defense response to insect Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT2G25080

ath:AT4G11600

ath:AT4G31870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · LXL04_029099 · OH-1004

Mitochondrion0.025

Rank 2 · LXL04_029099 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_029099 · OH-1004

Peroxisome0.015

Rank 4 · LXL04_029099 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_029099 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08534.17Redoxin82-228 aa

PF00578.28AhpC-TSA83-148 aa

PF00255.26GSHPx86-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029099	`PF08534.17`	Redoxin	82	228	1.4e-08	35.3
LXL04_029099	`PF00578.28`	AhpC-TSA	83	148	5.5e-09	36.7
LXL04_029099	`PF00255.26`	GSHPx	86	194	4.8e-42	142.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P52032`	Arabidopsis thaliana	Phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic	67.411%	Swiss-Prot	strong database homology
`Q9SZ54`	Arabidopsis thaliana	Putative glutathione peroxidase 7, chloroplastic	64.167%	Swiss-Prot	strong database homology
`O48646`	Arabidopsis thaliana	Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial	68.508%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card