LXL04_029048 | RubberDandelionOmics

Gene overview

LXL04_029048

Reference: OH-1004 Chr: Chr06 Coordinates: 79108346-79109653 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · LXL04_029048|LXL04_029048|OH1004|cDNA

ATGGCGTCGGCAAATTCCTTTACAGTAGGAGTAGGCAGCAGTGGTGGCGGTAGCTATGCAAACGGCGGTAGTAATCATAATGTTTTTGTTTACGGCAGTCTATTAGCCGACGAAGTTGTTCGTGTTCTCCTCCACCGCATCCCTCAAAATTCTCCTGCTATCCTTCACGGCTTTCATAGGTTTAGCATCAAAGGGCGTGTTTATCCTGCGATTCTACCCGTAGAAAACAAGAAAGTCACAGGGAGGGTTTTATTGGGGAT...

CDS

Download CDS FASTA

540 bp · LXL04_029048|LXL04_029048|OH1004|CDS

ATGGCGTCGGCAAATTCCTTTACAGTAGGAGTAGGCAGCAGTGGTGGCGGTAGCTATGCAAACGGCGGTAGTAATCATAATGTTTTTGTTTACGGCAGTCTATTAGCCGACGAAGTTGTTCGTGTTCTCCTCCACCGCATCCCTCAAAATTCTCCTGCTATCCTTCACGGCTTTCATAGGTTTAGCATCAAAGGGCGTGTTTATCCTGCGATTCTACCCGTAGAAAACAAGAAAGTCACAGGGAGGGTTTTATTGGGGAT...

Protein

Download Protein FASTA

179 aa · LXL04_029048|LXL04_029048|OH1004|PROTEIN

MASANSFTVGVGSSGGGSYANGGSNHNVFVYGSLLADEVVRVLLHRIPQNSPAILHGFHRFSIKGRVYPAILPVENKKVTGRVLLGISAPELEILDKFEDFEYEKKAVDVSLVGAPKDDVLQAYTYVWAKSNDTNLYGDWDFEVWKASKMKDFVNMTMGFVEQESNPRVVTYESYYKPE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029048`
TK1151 ID	TkA07G266310
OH-1004 ID	LXL04_029048
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029048

Location Chr06:79108346-79109653 (-)

Description Similar to AIG2LD: AIG2-like protein D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24390`	Putative gamma-glutamylcyclotransferase.	No verified direct reference in this release
`At4g31310`	Putative gamma-glutamylcyclotransferase.	No verified direct reference in this release
`At5g39730`	Putative gamma-glutamylcyclotransferase.	No verified direct reference in this release
`At3g28940`	Putative gamma-glutamylcyclotransferase.	No verified direct reference in this release
`At3g28930`	Putative gamma-glutamylcyclotransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029048 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0090358 positive regulation of L-tryptophan metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016746 acyltransferase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT2G24390

ath:AT3G28930

ath:AT3G28940

ath:AT4G31310

ath:AT5G39730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · LXL04_029048 · OH-1004

Nucleus0.422

Rank 2 · LXL04_029048 · OH-1004

Mitochondrion0.082

Rank 3 · LXL04_029048 · OH-1004

Cell membrane0.075

Rank 4 · LXL04_029048 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_029048 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06094.18GGACT28-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029048	`PF06094.18`	GGACT	28	141	2.9e-22	80.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A8MRP2`	Arabidopsis thaliana	AIG2-like protein D	57.343%	Swiss-Prot	strong database homology
`A2RVS4`	Arabidopsis thaliana	AIG2-like protein C	46.626%	Swiss-Prot	moderate database homology
`Q9FIX1`	Arabidopsis thaliana	AIG2-like protein B	42.657%	Swiss-Prot	moderate database homology
`Q9MBH2`	Arabidopsis thaliana	Protein AIG2 B	40.523%	Swiss-Prot	moderate database homology
`P54121`	Arabidopsis thaliana	Protein AIG2 A	37.975%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card