LXL04_029002 | RubberDandelionOmics

Gene overview

LXL04_029002

Reference: OH-1004 Chr: Chr06 Coordinates: 77548677-77549608 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · LXL04_029002|LXL04_029002|OH1004|cDNA

ATGAGCAGGTTTCGGTATCCTTACCTGTTGATCATGGGCGACGGTGCACCCACGGGTTCCGTACCAACATCAAAGCTGGAAGCCCAAATACTAGAGGCAGTATTACAACGAGAGCTGAAAGGAACTTCCATAAAGTCATTCAACAAGATAATCTTGAAATTTCCAAAAATCGACGAGAGCCTAAGAAAATGCAAAGTTATATTCGAACAGTTTGACGAGGATAAAAGCGGTGCAATTGATCTTAAAGAGCTGAAGAACTG...

CDS

Download CDS FASTA

681 bp · LXL04_029002|LXL04_029002|OH1004|CDS

ATGAGCAGGTTTCGGTATCCTTACCTGTTGATCATGGGCGACGGTGCACCCACGGGTTCCGTACCAACATCAAAGCTGGAAGCCCAAATACTAGAGGCAGTATTACAACGAGAGCTGAAAGGAACTTCCATAAAGTCATTCAACAAGATAATCTTGAAATTTCCAAAAATCGACGAGAGCCTAAGAAAATGCAAAGTTATATTCGAACAGTTTGACGAGGATAAAAGCGGTGCAATTGATCTTAAAGAGCTGAAGAACTG...

Protein

Download Protein FASTA

226 aa · LXL04_029002|LXL04_029002|OH1004|PROTEIN

MSRFRYPYLLIMGDGAPTGSVPTSKLEAQILEAVLQRELKGTSIKSFNKIILKFPKIDESLRKCKVIFEQFDEDKSGAIDLKELKNCFSKLEVTFTNEEISDIFQACDLNDDMGIDFHEFIVLLCLVYLLKEGSSAPNSKSRMGIPDLEATFETLVESFVFLDNNNDGYISKNEMIHAIEESGRSDGQITMKRFEEMDWDKNGTVNFKEFLFAFTSWVGIQDDEDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029002`
TK1151 ID	TkA07G260840
OH-1004 ID	LXL04_029002
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.133 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029002

Location Chr06:77548677-77549608 (+)

Description Similar to CML21: Probable calcium-binding protein CML21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26470`	Potential calcium sensor.	No verified direct reference in this release
`At3g24110`	Potential calcium sensor.	No verified direct reference in this release
`At4g04700`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At4g04695`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0491900`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029002 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G24110

ath:AT4G04695

ath:AT4G04700

ath:AT4G26470

dosa:Os05g0491900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.394

Rank 1 · LXL04_029002 · OH-1004

Cell membrane0.303

Rank 2 · LXL04_029002 · OH-1004

Nucleus0.216

Rank 3 · LXL04_029002 · OH-1004

Endoplasmic reticulum0.103

Rank 4 · LXL04_029002 · OH-1004

Golgi apparatus0.094

Rank 5 · LXL04_029002 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_763-121 aa

PF00036.39EF-hand_164-91 aa

PF13405.13EF-hand_665-90 aa

PF13202.13EF-hand_567-87 aa

PF13499.13EF-hand_7153-214 aa

PF13405.13EF-hand_6155-181 aa

PF00036.39EF-hand_1157-180 aa

PF00036.39EF-hand_1192-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029002	`PF13499.13`	EF-hand_7	63	121	1.8e-18	67.4
LXL04_029002	`PF00036.39`	EF-hand_1	64	91	1.7e-20	71.7
LXL04_029002	`PF13405.13`	EF-hand_6	65	90	2.8e-19	67.6
LXL04_029002	`PF13202.13`	EF-hand_5	67	87	1.2e-12	47.4
LXL04_029002	`PF13499.13`	EF-hand_7	153	214	1.8e-18	67.4
LXL04_029002	`PF13405.13`	EF-hand_6	155	181	2.8e-19	67.6
LXL04_029002	`PF00036.39`	EF-hand_1	157	180	1.7e-20	71.7
LXL04_029002	`PF00036.39`	EF-hand_1	192	215	1.7e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q52K82`	Arabidopsis thaliana	Probable calcium-binding protein CML21	68.159%	Swiss-Prot	strong database homology
`Q9LRN6`	Arabidopsis thaliana	Probable calcium-binding protein CML22	43.915%	Swiss-Prot	moderate database homology
`Q9ZSA4`	Arabidopsis thaliana	Calcium-dependent protein kinase 27	28.729%	Swiss-Prot	weak database homology
`Q9S9V0`	Arabidopsis thaliana	Calcium-dependent protein kinase 31	28.497%	Swiss-Prot	weak database homology
`B9FKW9`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 14	29.082%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card