LXL04_028991 | RubberDandelionOmics

Gene overview

LXL04_028991

Reference: OH-1004 Chr: Chr06 Coordinates: 77165782-77172218 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3240 bp · LXL04_028991|LXL04_028991|OH1004|cDNA

ATGGCAACGCAAACTTCTCATACCGTTCTGTCATTGAGAGGTTGCTCGCCATTTACAAAATCATCTTCATTTGGACTGATTGATTTCAGGAGATGTTCTTCTTCCATTGAGCTCTCATCTCTCTTCAATTTTACATATTGTTATATTTATCCTAGAAATGCTTATTGTACTCATTCAAAGAGAAGGTCTCGTGGGCCCGTTATGGCTGCCAAAAAAGAATCCAAAGGAACAAAGCAAGGAGATGGAAAATACAAGCATAC...

CDS

Download CDS FASTA

3240 bp · LXL04_028991|LXL04_028991|OH1004|CDS

ATGGCAACGCAAACTTCTCATACCGTTCTGTCATTGAGAGGTTGCTCGCCATTTACAAAATCATCTTCATTTGGACTGATTGATTTCAGGAGATGTTCTTCTTCCATTGAGCTCTCATCTCTCTTCAATTTTACATATTGTTATATTTATCCTAGAAATGCTTATTGTACTCATTCAAAGAGAAGGTCTCGTGGGCCCGTTATGGCTGCCAAAAAAGAATCCAAAGGAACAAAGCAAGGAGATGGAAAATACAAGCATAC...

Protein

Download Protein FASTA

1079 aa · LXL04_028991|LXL04_028991|OH1004|PROTEIN

MATQTSHTVLSLRGCSPFTKSSSFGLIDFRRCSSSIELSSLFNFTYCYIYPRNAYCTHSKRRSRGPVMAAKKESKGTKQGDGKYKHTVDLPKTSFGMRANSSIREPEIQKLWDENQVFKKVSEKNNGGSFILHDGPPYANGDLHMGHALNKIIKDIINRYKLLQNCKVHYIPGWDCHGLPIELKGNVAVIGSRCPKGVDTYKTESKSSQVCQSNREGTNGIFQGLVSRFGVWADWDHPYLTLDPEYEAAQIEVFGQMVFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028991`
TK1151 ID	TkA07G259400
OH-1004 ID	LXL04_028991
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028991

Location Chr06:77165782-77172218 (-)

Description Similar to OVA2: Isoleucine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49030`	Isoleucine--tRNA ligase, chloroplastic/mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028991 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006428 isoleucyl-tRNA aminoacylation Biological Process

GO:0032543 mitochondrial translation Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0004822 isoleucine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ana:alr1073

ath:AT5G49030

cyn:Cyan7425_3114

cyp:PCC8801_2707

npu:Npun_F1478

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.926

Rank 1 · LXL04_028991 · OH-1004

Mitochondrion0.134

Rank 2 · LXL04_028991 · OH-1004

Cytoplasm0.060

Rank 3 · LXL04_028991 · OH-1004

Peroxisome0.035

Rank 4 · LXL04_028991 · OH-1004

Nucleus0.023

Rank 5 · LXL04_028991 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133.29tRNA-synt_1108-757 aa

PF09334.18tRNA-synt_1g137-283 aa

PF13603.13tRNA-synt_1_2412-471 aa

PF08264.20Anticodon_1803-966 aa

PF06827.21zf-FPG_IleRS1037-1063 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028991	`PF00133.29`	tRNA-synt_1	108	757	2.7e-127	425.7
LXL04_028991	`PF09334.18`	tRNA-synt_1g	137	283	1.6e-19	70.6
LXL04_028991	`PF13603.13`	tRNA-synt_1_2	412	471	1.1e-06	29.0
LXL04_028991	`PF08264.20`	Anticodon_1	803	966	2.1e-29	103.0
LXL04_028991	`PF06827.21`	zf-FPG_IleRS	1037	1063	5.8e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXK8`	Arabidopsis thaliana	Isoleucine--tRNA ligase, chloroplastic/mitochondrial	70.370%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card