LXL04_028859 | RubberDandelionOmics

Gene overview

LXL04_028859

Reference: OH-1004 Chr: Chr06 Coordinates: 71204942-71209096 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4017 bp · LXL04_028859|LXL04_028859|OH1004|cDNA

ATGCAAAATCTGATCACGCAGCAACAGACAGAGATGAATCGGAAATTTGATATGATGATGGGCAAGCTGGAGAAGATGGACAGGGGCAAGACCATCGAGTTCCCACAATCTAGCGTGGTTACTCCCACACCCAGCCCAGTAGCAAAGGGGAACACCTCGGAAGGAACCAATGGAGGAAATACTTTCTTCGGAACGCCGGTGTCCACCGGAATGATATTCGGAAGCTATGACGGTACTAACCAGGGAAAAGGGGACCAAGG...

CDS

Download CDS FASTA

4017 bp · LXL04_028859|LXL04_028859|OH1004|CDS

ATGCAAAATCTGATCACGCAGCAACAGACAGAGATGAATCGGAAATTTGATATGATGATGGGCAAGCTGGAGAAGATGGACAGGGGCAAGACCATCGAGTTCCCACAATCTAGCGTGGTTACTCCCACACCCAGCCCAGTAGCAAAGGGGAACACCTCGGAAGGAACCAATGGAGGAAATACTTTCTTCGGAACGCCGGTGTCCACCGGAATGATATTCGGAAGCTATGACGGTACTAACCAGGGAAAAGGGGACCAAGG...

Protein

Download Protein FASTA

1338 aa · LXL04_028859|LXL04_028859|OH1004|PROTEIN

MQNLITQQQTEMNRKFDMMMGKLEKMDRGKTIEFPQSSVVTPTPSPVAKGNTSEGTNGGNTFFGTPVSTGMIFGSYDGTNQGKGDQGKGRYDYKHRKVDMPLFNGSDPDGWILLAERYFAIYQLINEKKLEAAILSLSGDALSWYRWSDRSIAGGDLYEQWSSLEQTGTTGDYICRFVELAAPLDGVTEHVALGNFIRGLKPIIKNELRLWGPDNLNRAMDLAQQLEEKNRDIRNSGYGALGARTQTLPVNRSATTYYPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028859`
TK1151 ID	TkA01G132070
OH-1004 ID	LXL04_028859
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.400
Protein coverage (%)	TK1151 64.706 / OH-1004 9.193 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_028859`
Location	Chr06:71204942-71209096 (-)
Description	Similar to Tf2-6: Transposon Tf2-6 polyprotein (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028859` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	spo:2538755 spo:2541833 spo:2541991 spo:3361422 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · LXL04_028859 · OH-1004

Nucleus0.456

Rank 2 · LXL04_028859 · OH-1004

Mitochondrion0.086

Rank 3 · LXL04_028859 · OH-1004

Cell membrane0.036

Rank 4 · LXL04_028859 · OH-1004

Endoplasmic reticulum0.031

Rank 5 · LXL04_028859 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03732.25PEG10_N-capsid97-164 aa

PF13650.12Asp_protease_2368-453 aa

PF08284.17RVP_2370-457 aa

PF30863.1PRO_PEG10-RTL1377-472 aa

PF00078.33RVT_1607-757 aa

PF17919.8RT_RNaseH_2753-841 aa

PF17917.8RT_RNaseH772-871 aa

PF17921.8Integrase_H2C2958-1014 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028859	`PF03732.25`	PEG10_N-capsid	97	164	7.7e-08	33.3
LXL04_028859	`PF13650.12`	Asp_protease_2	368	453	9e-06	27.0
LXL04_028859	`PF08284.17`	RVP_2	370	457	1.3e-08	35.4
LXL04_028859	`PF30863.1`	PRO_PEG10-RTL1	377	472	5.3e-06	27.5
LXL04_028859	`PF00078.33`	RVT_1	607	757	3e-35	122.6
LXL04_028859	`PF17919.8`	RT_RNaseH_2	753	841	1.2e-25	90.2
LXL04_028859	`PF17917.8`	RT_RNaseH	772	871	5.6e-26	91.4
LXL04_028859	`PF17921.8`	Integrase_H2C2	958	1014	6.6e-17	62.1
LXL04_028859	`PF24626.2`	SH3_Tf2-1	1230	1281	1.7e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card