LXL04_028783 | RubberDandelionOmics

Gene overview

LXL04_028783

Reference: OH-1004 Chr: Chr06 Coordinates: 62849963-62857998 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3327 bp · LXL04_028783|LXL04_028783|OH1004|cDNA

ATGAAGCGTTTTGTGTATGTCAATGACGACGATTCCTCCCATGAGCTTTACTGTGATAACCGTATATCCAACAGAAAGTACACATTGCTAAATTTTCTCCCCAAAAATCTATGGGAACAGTTCAGCCGGTTCATGAACCAATACTTTTTGTTGATCGCTTGTCTTCAACTATGGCCGCTTATAACGCCAGTAAACCCCGCTAGTACGTGGGGTCCGCTCATATTTATCTTCGCAGTCTCAGCAACAAAAGAGGCATGGGA...

CDS

Download CDS FASTA

3327 bp · LXL04_028783|LXL04_028783|OH1004|CDS

ATGAAGCGTTTTGTGTATGTCAATGACGACGATTCCTCCCATGAGCTTTACTGTGATAACCGTATATCCAACAGAAAGTACACATTGCTAAATTTTCTCCCCAAAAATCTATGGGAACAGTTCAGCCGGTTCATGAACCAATACTTTTTGTTGATCGCTTGTCTTCAACTATGGCCGCTTATAACGCCAGTAAACCCCGCTAGTACGTGGGGTCCGCTCATATTTATCTTCGCAGTCTCAGCAACAAAAGAGGCATGGGA...

Protein

Download Protein FASTA

1108 aa · LXL04_028783|LXL04_028783|OH1004|PROTEIN

MKRFVYVNDDDSSHELYCDNRISNRKYTLLNFLPKNLWEQFSRFMNQYFLLIACLQLWPLITPVNPASTWGPLIFIFAVSATKEAWDDYNRYLSDKKANEKQVWVVRQGSKKLIQAQEIHVGNLVWLRENDEVPCDLVLLGTSEPQGVCYVETAALDGETDLKTRNIPPACMGIDSELLHKIKARYGYRGVMECPLPDKDIRRFDANVRLFPPFLDNDVCPLSIKNTILQSCYLRNTEWACGVAVYTGNETKMGMSRGVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028783`
TK1151 ID	TkA07G213750
OH-1004 ID	LXL04_028783
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.800
Protein coverage (%)	TK1151 98.098 / OH-1004 75.361 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028783

Location Chr06:62849963-62857998 (+)

Description Similar to ALA2: Phospholipid-transporting ATPase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44240`	Involved in transport of phospholipids.	Intracellular targeting signals and lipid specificity determinants of the ALA/ALIS P4-ATPase complex reside in the catalytic ALA alpha-subunit.2010 · DOI: 10.1091/mbc.e09-08-0656

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028783 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007030 Golgi organization Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:0061092 positive regulation of phospholipid translocation Biological Process

GO:0140331 aminophospholipid translocation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT5G44240

bta:317692

hsa:10396

hsa:79895

mmu:11980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.418

Rank 1 · LXL04_028783 · OH-1004

Endoplasmic reticulum0.279

Rank 2 · LXL04_028783 · OH-1004

Cytoplasm0.228

Rank 3 · LXL04_028783 · OH-1004

Golgi apparatus0.213

Rank 4 · LXL04_028783 · OH-1004

Lysosome / Vacuole0.149

Rank 5 · LXL04_028783 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209.11PhoLip_ATPase_N5-70 aa

PF00122.26E1-E2_ATPase99-162 aa

PF13246.13Cation_ATPase435-625 aa

PF00702.33Hydrolase567-774 aa

PF16212.12PhoLip_ATPase_C788-1025 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028783	`PF16209.11`	PhoLip_ATPase_N	5	70	1.5e-25	89.4
LXL04_028783	`PF00122.26`	E1-E2_ATPase	99	162	3.7e-07	30.6
LXL04_028783	`PF13246.13`	Cation_ATPase	435	625	5.8e-17	62.8
LXL04_028783	`PF00702.33`	Hydrolase	567	774	2.1e-12	48.5
LXL04_028783	`PF16212.12`	PhoLip_ATPase_C	788	1025	1.1e-64	219.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P98205`	Arabidopsis thaliana	Phospholipid-transporting ATPase 2	82.251%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card