Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2955 bp · LXL04_028734|LXL04_028734|OH1004|cDNA
ATGATGATCGGAGACTTTGAAATTGATAACGGAGATTTGACTCAAAAATCTATCTCTAAAAAAGaaagaaaaaaaaaagaaacaatcaAGAATATTGGAGGACTCATGGAggtcaaaataaaaaaacaaaaggttgttTCTTATGATATTATTCAACGTAGAAAAGAAAAACGTAAAAAAGTTAATCAAAAATATCATGCACAGAAAAGGGACAAACAACAAATAGAAACTGAGCCGTTACAAAATATAGATAACCAACC...
2955 bp · LXL04_028734|LXL04_028734|OH1004|CDS
ATGATGATCGGAGACTTTGAAATTGATAACGGAGATTTGACTCAAAAATCTATCTCTAAAAAAGAAAGAAAAAAAAAAGAAACAATCAAGAATATTGGAGGACTCATGGAGGTCAAAATAAAAAAACAAAAGGTTGTTTCTTATGATATTATTCAACGTAGAAAAGAAAAACGTAAAAAAGTTAATCAAAAATATCATGCACAGAAAAGGGACAAACAACAAATAGAAACTGAGCCGTTACAAAATATAGATAACCAACC...
Protein
Download Protein FASTA984 aa · LXL04_028734|LXL04_028734|OH1004|PROTEIN
MMIGDFEIDNGDLTQKSISKKERKKKETIKNIGGLMEVKIKKQKVVSYDIIQRRKEKRKKVNQKYHAQKRDKQQIETEPLQNIDNQPRQRTIRYANNASTSRGIGPIDKENISPHSNGNVSHVQNDFSKECNKMTERNKQRGKNKILFTTGETIEEQNDARYYEIGNNEETSITGEHHFIHDEENTEICSPITYETQNEVRDDTEVHLNPINEDDPYDFVYDRTPVVHRVLAGRTKYNDLTNMKSGVYTFRAHGGIYHRI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_028734 |
|---|---|
| TK1151 ID | TkA07G199270 |
| OH-1004 ID | LXL04_028734 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 33.300 |
| Protein coverage (%) | TK1151 99.344 / OH-1004 92.276Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_028734 |
|---|---|
| Location | Chr06:58126680-58131235 (+) |
| Description | Similar to PIF4: ATP-dependent DNA helicase PIF4 (Trypanosoma brucei brucei (strain 927/4 GUTat10.1) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000722 telomere maintenance via recombination Biological Process GO:0000723 telomere maintenance Biological Process GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0001117 protein-DNA-RNA complex disassembly Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0019985 translesion synthesis Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0051276 chromosome organization Biological Process GO:0071932 replication fork reversal Biological Process GO:0000781 chromosome, telomeric region Cellular Component |
| KEGG gene cross-reference | cal:CAALFM_CR07360WA hsa:80119 prw:PsycPRwf_1560 tbr:Tb11.01.6420 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14214.12Helitron_like_N404-547 aaPF05970.21PIF1789-945 aaPF13604.13AAA_30789-915 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_028734 | PF14214.12 | Helitron_like_N | 404 | 547 | 1.7e-43 | 149.8 |
| LXL04_028734 | PF05970.21 | PIF1 | 789 | 945 | 3.1e-58 | 197.7 |
| LXL04_028734 | PF13604.13 | AAA_30 | 789 | 915 | 9.5e-07 | 29.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.