LXL04_028586 | RubberDandelionOmics

Gene overview

LXL04_028586

Reference: OH-1004 Chr: Chr06 Coordinates: 46665673-46675116 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · LXL04_028586|LXL04_028586|OH1004|cDNA

ATGGCAGTGTCACTCTCCGCCGCTGGAGTCCGGCACCTACATGGCAGCTCTGCATTGGCTCCCAGGGACTTGAGGCCTTTATATTGCGACTTAATGGGGAAAAAGCTAAATTTCAGTCAAAGGGTTCAAAAGAAAAACAATGTTAAATCAAGCATACAAATGACGCTCACCACCATTGCCACAAGCGAGGGAAAGTTAAGGGACTTGGAGATGGAGAAACGGGACCCGAGAACTGTTGTGGCGGTGATACTTGGCGGTGG...

CDS

Download CDS FASTA

1533 bp · LXL04_028586|LXL04_028586|OH1004|CDS

ATGGCAGTGTCACTCTCCGCCGCTGGAGTCCGGCACCTACATGGCAGCTCTGCATTGGCTCCCAGGGACTTGAGGCCTTTATATTGCGACTTAATGGGGAAAAAGCTAAATTTCAGTCAAAGGGTTCAAAAGAAAAACAATGTTAAATCAAGCATACAAATGACGCTCACCACCATTGCCACAAGCGAGGGAAAGTTAAGGGACTTGGAGATGGAGAAACGGGACCCGAGAACTGTTGTGGCGGTGATACTTGGCGGTGG...

Protein

Download Protein FASTA

510 aa · LXL04_028586|LXL04_028586|OH1004|PROTEIN

MAVSLSAAGVRHLHGSSALAPRDLRPLYCDLMGKKLNFSQRVQKKNNVKSSIQMTLTTIATSEGKLRDLEMEKRDPRTVVAVILGGGAGTRLFPLTKRRAKPAVPIGGAYRLIDVPMSNCINSGINKVYILTQYNSASLNRHLARAYNFGVTFGDGFVEALSATQTPGVEGKRWFQGTADAVRQFHWLFEDARSKDIEDVLILSGDHLYRMDYMDFVQNHRQSGADITISCLPMDDSRASDFGLMKIDGKGRVLSFSEKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028586`
TK1151 ID	TkA07G173160
OH-1004 ID	LXL04_028586
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028586

Location Chr06:46665673-46675116 (-)

Description Similar to ADG2: Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19220`	This protein plays a role in synthesis of starch.	No verified direct reference in this release
`At1g27680`	This protein plays a role in synthesis of starch.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0735000`	Involved in synthesis of starch.	Identification of the ADP-glucose pyrophosphorylase isoforms essential for starch synthesis in the leaf and seed endosperm of rice (Oryza sativa L.).2007 · DOI: 10.1007/s11103-007-9153-z

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028586 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005978 glycogen biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010170 glucose-1-phosphate adenylyltransferase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008878 glucose-1-phosphate adenylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G27680

ath:AT5G19220

bvg:104889614

dosa:Os03g0735000

sot:102582750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.960

Rank 1 · LXL04_028586 · OH-1004

Mitochondrion0.060

Rank 2 · LXL04_028586 · OH-1004

Cytoplasm0.032

Rank 3 · LXL04_028586 · OH-1004

Peroxisome0.026

Rank 4 · LXL04_028586 · OH-1004

Nucleus0.018

Rank 5 · LXL04_028586 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00483.30NTP_transferase81-356 aa

PF25247.2LbH_GLGC375-509 aa

PF24894.2Hexapep_GlmU384-437 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028586	`PF00483.30`	NTP_transferase	81	356	9.3e-70	235.7
LXL04_028586	`PF25247.2`	LbH_GLGC	375	509	1.7e-49	168.0
LXL04_028586	`PF24894.2`	Hexapep_GlmU	384	437	3e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55229`	Arabidopsis thaliana	Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic	80.855%	Swiss-Prot	strong database homology
`P55230`	Arabidopsis thaliana	Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic	64.016%	Swiss-Prot	strong database homology
`Q6AVT2`	Oryza sativa subsp. japonica	Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic/amyloplastic	83.596%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card