LXL04_028541 | RubberDandelionOmics

Gene overview

LXL04_028541

Reference: OH-1004 Chr: Chr06 Coordinates: 45271158-45272183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · LXL04_028541|LXL04_028541|OH1004|cDNA

ATGAGTTTGGGAATGGCAGAGGATGATTCCGGTACGGATATCCATCTCCCAGCTGACATTGATTGGGAAATGCTAGATAAATCCAAGTTTTTCTTCCTTGGTGCCGCCTTATTTTCTGGTGTTTCCGGTACGTTGTACCCGACGGTGGTATTAAAAACACGGCAACAAGTACTTGTAAAAGACACTTGTTTCAAAATGGCCGTCTCGATTCTCCGGCATGATGGATTCAGGGGATTTTATAGAGGATTTGGGACGTCGTT...

CDS

Download CDS FASTA

1026 bp · LXL04_028541|LXL04_028541|OH1004|CDS

ATGAGTTTGGGAATGGCAGAGGATGATTCCGGTACGGATATCCATCTCCCAGCTGACATTGATTGGGAAATGCTAGATAAATCCAAGTTTTTCTTCCTTGGTGCCGCCTTATTTTCTGGTGTTTCCGGTACGTTGTACCCGACGGTGGTATTAAAAACACGGCAACAAGTACTTGTAAAAGACACTTGTTTCAAAATGGCCGTCTCGATTCTCCGGCATGATGGATTCAGGGGATTTTATAGAGGATTTGGGACGTCGTT...

Protein

Download Protein FASTA

341 aa · LXL04_028541|LXL04_028541|OH1004|PROTEIN

MSLGMAEDDSGTDIHLPADIDWEMLDKSKFFFLGAALFSGVSGTLYPTVVLKTRQQVLVKDTCFKMAVSILRHDGFRGFYRGFGTSLVGTVPARALYMGALEMTKSSVGCTTMKMGFTEAKAAAIANAAAGVTAAMAAQLVWTPIDVVSQRLMVQGGNSVKTIGLTGVRYTGGVDAFRKIVQTQGVRGLYRGFGISTLTYAPSNAVWWASYSMAHRSIWDGIGYHLKRDGNGGVGFTPDPKAVVGVQAVSAVVASGVSAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028541`
TK1151 ID	TkA07G168740
OH-1004 ID	LXL04_028541
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028541

Location Chr06:45271158-45272183 (+)

Description Similar to SLC25A44: Solute carrier family 25 member 44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34065`	Probable S-adenosylmethionine (SAM) transporter able to catalyze both uniport and exchange reactions through membranes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028541 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0015803 branched-chain amino acid transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0120161 regulation of cold-induced thermogenesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0000095 S-adenosyl-L-methionine transmembrane transporter activity Molecular Function

GO:0015658 branched-chain amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34065

ddi:DDB_G0280083

hsa:9673

mmu:229517

pon:100172017

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.916

Rank 1 · LXL04_028541 · OH-1004

Cytoplasm0.038

Rank 2 · LXL04_028541 · OH-1004

Nucleus0.029

Rank 3 · LXL04_028541 · OH-1004

Plastid0.024

Rank 4 · LXL04_028541 · OH-1004

Cell membrane0.023

Rank 5 · LXL04_028541 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr42-107 aa

PF00153.33Mito_carr124-218 aa

PF00153.33Mito_carr246-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028541	`PF00153.33`	Mito_carr	42	107	3.4e-52	174.8
LXL04_028541	`PF00153.33`	Mito_carr	124	218	3.4e-52	174.8
LXL04_028541	`PF00153.33`	Mito_carr	246	332	3.4e-52	174.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HT41`	Arabidopsis thaliana	Probable S-adenosylmethionine carrier 2, chloroplastic	29.373%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card