LXL04_028479 | RubberDandelionOmics

Gene overview

LXL04_028479

Reference: OH-1004 Chr: Chr06 Coordinates: 43208083-43212669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · LXL04_028479|LXL04_028479|OH1004|cDNA

ATGGAGAGATCCAAGTCAATGCCCCCAGCTAATGGGAAGTTGATCACAGTTCTTAGCATCGATGGTGGTGGAATCAGAGGTCTTATCCCAGCTATCATCCTCAACGTTCTTGAGACTGAGCTGCAGAATTTAGATGGAAAAGACGCAAGAATAGCAGACTATTTTGATATAATTGCTGGGACGAGTACTGGTGGTCTAATCACTGCGATGTTAACCGCTCCCAATGAAAAGAAGCGTCCTTTGTTCGCGGCTTCGGAGAT...

CDS

Download CDS FASTA

1557 bp · LXL04_028479|LXL04_028479|OH1004|CDS

ATGGAGAGATCCAAGTCAATGCCCCCAGCTAATGGGAAGTTGATCACAGTTCTTAGCATCGATGGTGGTGGAATCAGAGGTCTTATCCCAGCTATCATCCTCAACGTTCTTGAGACTGAGCTGCAGAATTTAGATGGAAAAGACGCAAGAATAGCAGACTATTTTGATATAATTGCTGGGACGAGTACTGGTGGTCTAATCACTGCGATGTTAACCGCTCCCAATGAAAAGAAGCGTCCTTTGTTCGCGGCTTCGGAGAT...

Protein

Download Protein FASTA

518 aa · LXL04_028479|LXL04_028479|OH1004|PROTEIN

MERSKSMPPANGKLITVLSIDGGGIRGLIPAIILNVLETELQNLDGKDARIADYFDIIAGTSTGGLITAMLTAPNEKKRPLFAASEIKEFYLQKCRKIFPQNRVKLFILRVVFARNYAGIGSAGAETPKQSPPPLLHLPILYLSFSDRFLSVAVASSFCHHNSVSYAVATSSSLCQAVDIAAPQDLAIAAAARSNTLTRMVKNLFGPLYDGKYLHECIRKRLGNKRLEDTLTNVAIPTFDISTLQPTIFSSLEMKKKPYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028479`
TK1151 ID	TkA07G161340
OH-1004 ID	LXL04_028479
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028479

Location Chr06:43208083-43212669 (-)

Description Similar to PLP2: Patatin-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37050`	Possesses non-specific lipolytic acyl hydrolase (LAH) activity.	No verified direct reference in this release
`At2g26560`	Possesses non-specific lipolytic acyl hydrolase (LAH) activity.	A pathogen-inducible patatin-like lipid acyl hydrolase facilitates fungal and bacterial host colonization in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02578.x The Arabidopsis patatin-like protein 2 (PLP2) plays an essential role in cell death execution and differentially affects biosynthesis of oxylipins and resistance to pathogens.2009 · DOI: 10.1094/mpmi-22-4-0469

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0477500`	Possesses non-specific lipolytic acyl hydrolase (LAH) activity.	No verified direct reference in this release
`UniProt: A2YW91`	Possesses non-specific lipolytic acyl hydrolase (LAH) activity.	No verified direct reference in this release
`Os03g0393900`	Possesses non-specific lipolytic acyl hydrolase (LAH) activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028479 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0004620 glycerophospholipase activity Molecular Function

GO:0047372 monoacylglycerol lipase activity Molecular Function

KEGG gene cross-reference

ath:AT4G37050

dosa:Os08g0477500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · LXL04_028479 · OH-1004

Nucleus0.219

Rank 2 · LXL04_028479 · OH-1004

Cell membrane0.189

Rank 3 · LXL04_028479 · OH-1004

Endoplasmic reticulum0.129

Rank 4 · LXL04_028479 · OH-1004

Lysosome / Vacuole0.090

Rank 5 · LXL04_028479 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01734.28Patatin18-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028479	`PF01734.28`	Patatin	18	311	6.2e-26	92.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23181`	Arabidopsis thaliana	Patatin-like protein 3	50.508%	Swiss-Prot	moderate database homology
`O48723`	Arabidopsis thaliana	Patatin-like protein 2	49.508%	Swiss-Prot	moderate database homology
`Q6ZJD3`	Oryza sativa subsp. japonica	Patatin-like protein 2	51.890%	Swiss-Prot	moderate database homology
`A2YW91`	Oryza sativa subsp. indica	Patatin-like protein 2	51.890%	Swiss-Prot	moderate database homology
`Q84QY3`	Oryza sativa subsp. japonica	Patatin-like protein 1	45.246%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card