LXL04_028453 | RubberDandelionOmics

Gene overview

LXL04_028453

Reference: OH-1004 Chr: Chr06 Coordinates: 42251348-42255588 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · LXL04_028453|LXL04_028453|OH1004|cDNA

ATGGCTAAACCTAGGTTTGGCAAGAAACGAGGATTCGGCAGGCCAAAAGCAAATGAATTTACAGAGAATATTAAAAACAAGCGCCTCAGAAGAAATCATGTCGAAGATGAGAAAATTCCAGATACACCTTCCTCTCCTAACAATTCATCAGAAGAACACTCTGATATTGCTTCAGAAGATGAACAAGAAGAGGTTCCTGTTTACAAAGAACCATCAATGTATGATAACCTGCTGAAGACACTTGGGTCAGCTAGTGAGTC...

CDS

Download CDS FASTA

2250 bp · LXL04_028453|LXL04_028453|OH1004|CDS

ATGGCTAAACCTAGGTTTGGCAAGAAACGAGGATTCGGCAGGCCAAAAGCAAATGAATTTACAGAGAATATTAAAAACAAGCGCCTCAGAAGAAATCATGTCGAAGATGAGAAAATTCCAGATACACCTTCCTCTCCTAACAATTCATCAGAAGAACACTCTGATATTGCTTCAGAAGATGAACAAGAAGAGGTTCCTGTTTACAAAGAACCATCAATGTATGATAACCTGCTGAAGACACTTGGGTCAGCTAGTGAGTC...

Protein

Download Protein FASTA

749 aa · LXL04_028453|LXL04_028453|OH1004|PROTEIN

MAKPRFGKKRGFGRPKANEFTENIKNKRLRRNHVEDEKIPDTPSSPNNSSEEHSDIASEDEQEEVPVYKEPSMYDNLLKTLGSASESFADAYKRRQRAEEGKSDTDEDEDNDSESLSVSEEEEDETESESAGGDSDQNVLEGSSLGEAKEHSEDDADEAFDTDEEEKEELTVDDQVIAKDLETSSSFSDHLGYKLLKEEIESLSGKKGKYKYEVDAANCKWVATKELHLEMDPPYGLHPKLYDHWLNIYKASGGHDLHSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028453`
TK1151 ID	TkA07G157460
OH-1004 ID	LXL04_028453
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028453

Location Chr06:42251348-42255588 (-)

Description Similar to diexf: Digestive organ expansion factor homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17690`	DEAD-box RNA helicase-like protein required for pre-18S rRNA processing, specifically at sites A0, A1, and A2 (By similarity).	NOF1 encodes an Arabidopsis protein involved in the control of rRNA expression.2010 · DOI: 10.1371/journal.pone.0012829

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028453 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0009303 rRNA transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0031648 protein destabilization Biological Process

GO:0040019 positive regulation of embryonic development Biological Process

GO:1902570 protein localization to nucleolus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0032040 small-subunit processome Cellular Component

KEGG gene cross-reference

ath:AT1G17690

gga:421384

hsa:27042

xtr:493397

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · LXL04_028453 · OH-1004

Cytoplasm0.132

Rank 2 · LXL04_028453 · OH-1004

Mitochondrion0.024

Rank 3 · LXL04_028453 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_028453 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_028453 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22916.3UTP25_NTPase-like272-560 aa

PF06862.18Utp25_C571-748 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028453	`PF22916.3`	UTP25_NTPase-like	272	560	2.8e-106	355.6
LXL04_028453	`PF06862.18`	Utp25_C	571	748	6.9e-63	212.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1E7`	Arabidopsis thaliana	Protein NUCLEOLAR FACTOR 1	60.057%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card