RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_028452
Reference: OH-1004 Chr: Chr06 Coordinates: 42245998-42249379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2271 bp · LXL04_028452|LXL04_028452|OH1004|cDNA

ATGGCAACCGAAAGTCCGATCCGAATCATTGAAGCAAATAGAAAATGGAATGATATAAACATGGGAATCGAGGAGATGGGATTGGGCTTAAATTCCCAAAGATTCCATAATCCAACTCCTAATCGAAGTGGAAGTGCACCTCCAAGTATCGAAGGTTCATTTGCCGCCATTGAAAACCTCATGTTTAGGCAACACTTTGCCAGAGATGTTCCTAATGTTCCCGAGTCTGAAGAACAACTTAGAGCCGATCCATCTTATTT...

CDS

Download CDS FASTA

2271 bp · LXL04_028452|LXL04_028452|OH1004|CDS

ATGGCAACCGAAAGTCCGATCCGAATCATTGAAGCAAATAGAAAATGGAATGATATAAACATGGGAATCGAGGAGATGGGATTGGGCTTAAATTCCCAAAGATTCCATAATCCAACTCCTAATCGAAGTGGAAGTGCACCTCCAAGTATCGAAGGTTCATTTGCCGCCATTGAAAACCTCATGTTTAGGCAACACTTTGCCAGAGATGTTCCTAATGTTCCCGAGTCTGAAGAACAACTTAGAGCCGATCCATCTTATTT...

Protein

Download Protein FASTA

756 aa · LXL04_028452|LXL04_028452|OH1004|PROTEIN

MATESPIRIIEANRKWNDINMGIEEMGLGLNSQRFHNPTPNRSGSAPPSIEGSFAAIENLMFRQHFARDVPNVPESEEQLRADPSYFAYYWAHVNLNPRLPPPLVSDENRNHFRNVRNTGNSNKRLTSFDDSFSGSLQLDHSSLSTHKEESDDEISPKEEDLPFIPEPKEEKENQKDSNNPTTTTVSSSETDVSTLRNRIASLNIPNIPKIESERNQEDSSTYQQQRNMLHIHGTHPQIVSLPQTSYVMNQNYMSEVRST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_028452
TK1151 IDTkA07G157450
OH-1004 IDLXL04_028452
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_028452
LocationChr06:42245998-42249379 (+)
DescriptionSimilar to APUM5: Pumilio homolog 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g20250 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At4g25880 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At2g29190 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At2g29140 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At2g29200 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028452 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006417 regulation of translation Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009819 drought recovery Biological Process
GO:0010608 post-transcriptional regulation of gene expression Biological Process
GO:0051607 defense response to virus Biological Process
GO:0061158 3'-UTR-mediated mRNA destabilization Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT2G29190
ath:AT4G25880
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.771
Rank 1 · LXL04_028452 · OH-1004
Nucleus0.253
Rank 2 · LXL04_028452 · OH-1004
Cell membrane0.072
Rank 3 · LXL04_028452 · OH-1004
Lysosome / Vacuole0.049
Rank 4 · LXL04_028452 · OH-1004
Golgi apparatus0.042
Rank 5 · LXL04_028452 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00806.26PUF432-465 aa
PF00806.26PUF470-496 aa
PF00806.26PUF503-536 aa
PF00806.26PUF539-561 aa
PF22493.3PUF_NOP9539-620 aa
PF00806.26PUF576-610 aa
PF00806.26PUF613-645 aa
PF00806.26PUF648-682 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_028452PF00806.26PUF4324655e-82269.4
LXL04_028452PF00806.26PUF4704965e-82269.4
LXL04_028452PF00806.26PUF5035365e-82269.4
LXL04_028452PF00806.26PUF5395615e-82269.4
LXL04_028452PF22493.3PUF_NOP95396204.3e-2176.1
LXL04_028452PF00806.26PUF5766105e-82269.4
LXL04_028452PF00806.26PUF6136455e-82269.4
LXL04_028452PF00806.26PUF6486825e-82269.4
LXL04_028452PF00806.26PUF6947215e-82269.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LJX4Arabidopsis thalianaPumilio homolog 564.516%Swiss-Protmoderate database homology
Q9C5E7Arabidopsis thalianaPumilio homolog 6, chloroplastic39.462%Swiss-Protmoderate database homology
Q9ZW06Arabidopsis thalianaPumilio homolog 262.209%Swiss-Protweak database homology
Q9ZW02Arabidopsis thalianaPumilio homolog 355.668%Swiss-Protmoderate database homology
Q9ZW07Arabidopsis thalianaPumilio homolog 155.919%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser