LXL04_028402 | RubberDandelionOmics

Gene overview

LXL04_028402

Reference: OH-1004 Chr: Chr06 Coordinates: 40516917-40519154 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_028402|LXL04_028402|OH1004|cDNA

ATGCAATCGAGCCAAACATGGATTCAAGCCTTGTTCTACCTCGCTCTCATCACTGTTTCACTGTATTTGCTTCAGTTTTTTATTCTATCCGATAGATTAATGGTGTCTCATCACAAAGTTATTCTCAAGAAACATCCTCATTTTCCTCTACGGTTCAATTCCGACGGCACTTTTAAGATCCTTCAGGTTAACTTTCAAATTCATTTCAGAGCTTTAAAGGTGGCTGATATGCATTATGGAACTGGATTGACTCGGTGTAG...

CDS

Download CDS FASTA

1194 bp · LXL04_028402|LXL04_028402|OH1004|CDS

ATGCAATCGAGCCAAACATGGATTCAAGCCTTGTTCTACCTCGCTCTCATCACTGTTTCACTGTATTTGCTTCAGTTTTTTATTCTATCCGATAGATTAATGGTGTCTCATCACAAAGTTATTCTCAAGAAACATCCTCATTTTCCTCTACGGTTCAATTCCGACGGCACTTTTAAGATCCTTCAGGTTAACTTTCAAATTCATTTCAGAGCTTTAAAGGTGGCTGATATGCATTATGGAACTGGATTGACTCGGTGTAG...

Protein

Download Protein FASTA

397 aa · LXL04_028402|LXL04_028402|OH1004|PROTEIN

MQSSQTWIQALFYLALITVSLYLLQFFILSDRLMVSHHKVILKKHPHFPLRFNSDGTFKILQVNFQIHFRALKVADMHYGTGLTRCRDVLSSEFEWCSDLNTTSFLKRMIDAEKPDFIAFTGDNIFGSSTNDAAESLFKAFAPAMAARLPWAAVLGNHDQESTMTREELMSFISLMDYSVSQPNPPTIPPTHIDGFGNYDLKVRGPPGSHLANQTILNLFFLDSGDRALVHGFKTYGWIKESQLTWLRTASKGRNEETNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028402`
TK1151 ID	TkA07G151920
OH-1004 ID	LXL04_028402
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.800
Protein coverage (%)	TK1151 83.103 / OH-1004 63.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028402

Location Chr06:40516917-40519154 (+)

Description Similar to PAP28: Probable inactive purple acid phosphatase 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57140`	Probable inactive purple acid phosphatase 28.	No verified direct reference in this release
`At5g63140`	Probable inactive purple acid phosphatase 29.	No verified direct reference in this release
`At2g46880`	Probable inactive purple acid phosphatase 14.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028402 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007089 traversing start control point of mitotic cell cycle Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:1900102 negative regulation of endoplasmic reticulum unfolded protein response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G46880

ath:AT5G57140

ath:AT5G63140

sce:YLR361C

spo:2538828

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.428

Rank 1 · LXL04_028402 · OH-1004

Golgi apparatus0.163

Rank 2 · LXL04_028402 · OH-1004

Extracellular0.156

Rank 3 · LXL04_028402 · OH-1004

Endoplasmic reticulum0.138

Rank 4 · LXL04_028402 · OH-1004

Cytoplasm0.123

Rank 5 · LXL04_028402 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149.34Metallophos74-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028402	`PF00149.34`	Metallophos	74	321	3.6e-12	47.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU72`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 28	58.794%	Swiss-Prot	strong database homology
`Q9FMK9`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 29	50.704%	Swiss-Prot	strong database homology
`Q84LR6`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 14	49.438%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card