LXL04_028381 | RubberDandelionOmics

Gene overview

LXL04_028381

Reference: OH-1004 Chr: Chr06 Coordinates: 39486830-39490738 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1845 bp · LXL04_028381|LXL04_028381|OH1004|cDNA

ATGGCGGACGTGGATGCTAACGTCTCAATCGGCAACTCAGCGCCTGCTCCACCGGAGTCAGAGGTTTTAAGCAAGAATGCTCAAAAGAAGGAGCTAAAGAACAAACAGAAGGAGGAAGAGAGGCGTCGCAAGGAAGAGGAGAAGGCGAAAAAGGCTGCTGCCATGCCAAAGTCTGCAGTACAGAAGCAGTCTGCTGCAGATGATGAAGACATGGATCCAACGCAATATTTTGAAAACCGCCTGAAAACACTTGCTACTCA...

CDS

Download CDS FASTA

1845 bp · LXL04_028381|LXL04_028381|OH1004|CDS

ATGGCGGACGTGGATGCTAACGTCTCAATCGGCAACTCAGCGCCTGCTCCACCGGAGTCAGAGGTTTTAAGCAAGAATGCTCAAAAGAAGGAGCTAAAGAACAAACAGAAGGAGGAAGAGAGGCGTCGCAAGGAAGAGGAGAAGGCGAAAAAGGCTGCTGCCATGCCAAAGTCTGCAGTACAGAAGCAGTCTGCTGCAGATGATGAAGACATGGATCCAACGCAATATTTTGAAAACCGCCTGAAAACACTTGCTACTCA...

Protein

Download Protein FASTA

614 aa · LXL04_028381|LXL04_028381|OH1004|PROTEIN

MADVDANVSIGNSAPAPPESEVLSKNAQKKELKNKQKEEERRRKEEEKAKKAAAMPKSAVQKQSAADDEDMDPTQYFENRLKTLATQKAAGNNPYPHKFHVSMSILEYINKYESLNNGDHLEDVQVSLAGRLMNKRSSSSKLFFYDLHGTGGKVQVMADARKSDLDEEEFTKYHSGVKRGDIVGIVGFPGKSKRGELSIFPKTFTVLSHCLHMMPRQKSAAVAENANVKKIDAWTPGSGRNPEAYILKDQETRYRQRYLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028381`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028381

Location Chr06:39486830-39490738 (+)

Description Similar to At3g11710: Lysine--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11710`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0586800`	Lysine--tRNA ligase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028381 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006430 lysyl-tRNA aminoacylation Biological Process

GO:0010165 response to X-ray Biological Process

GO:0015966 diadenosine tetraphosphate biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0070371 ERK1 and ERK2 cascade Biological Process

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G11710

dosa:Os03g0586800

mmu:85305

sly:778357

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.661

Rank 1 · LXL04_028381 · OH-1004

Nucleus0.315

Rank 2 · LXL04_028381 · OH-1004

Mitochondrion0.154

Rank 3 · LXL04_028381 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_028381 · OH-1004

Peroxisome0.039

Rank 5 · LXL04_028381 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01336.32tRNA_anti-codon126-207 aa

PF00152.26tRNA-synt_2249-598 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028381	`PF01336.32`	tRNA_anti-codon	126	207	4.1e-12	46.6
LXL04_028381	`PF00152.26`	tRNA-synt_2	249	598	6.6e-93	311.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPI1`	Arabidopsis thaliana	Lysine--tRNA ligase, cytoplasmic	79.286%	Swiss-Prot	strong database homology
`Q6F2U9`	Oryza sativa subsp. japonica	Lysine--tRNA ligase	80.037%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card