LXL04_028345 | RubberDandelionOmics

Gene overview

LXL04_028345

Reference: OH-1004 Chr: Chr06 Coordinates: 38556678-38558364 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · LXL04_028345|LXL04_028345|OH1004|cDNA

TTTGAGGACCGCCTTACACGTGTATCGGtagataaatatatatatagcacccACAGATGGACTGGATATCTTAAGACACCACTTGTCCACTTCAGACGTCACACGATGGCCTCTTCGTCTTGTTTATACGCACAAATCAGCAGCATACTCCTTATATTCTCTATACAGCTCTTTCTGGTTGTTTATGCCGACGGCGGCACCAACTTCAACAACAACTTTGACATCACTTGGGGTGGTGGCCGTGGCAAGATCACCGGCGA...

CDS

Download CDS FASTA

828 bp · LXL04_028345|LXL04_028345|OH1004|CDS

ATGGCCTCTTCGTCTTGTTTATACGCACAAATCAGCAGCATACTCCTTATATTCTCTATACAGCTCTTTCTGGTTGTTTATGCCGACGGCGGCACCAACTTCAACAACAACTTTGACATCACTTGGGGTGGTGGCCGTGGCAAGATCACCGGCGACATTCTGACACTGTCCCTCGATAGAGTCTCCGGGTCAGGATTCCAGTCGAAGAAGGAGTATCTATTTGGCAGAATCGACATGCAAATGAAGCTTGTGCCTGGAAA...

Protein

Download Protein FASTA

275 aa · LXL04_028345|LXL04_028345|OH1004|PROTEIN

MASSSCLYAQISSILLIFSIQLFLVVYADGGTNFNNNFDITWGGGRGKITGDILTLSLDRVSGSGFQSKKEYLFGRIDMQMKLVPGNSAGTVTAYYLSSQGASHDEIDFEFLGNLTGEPYTLHTNVYTQGKGEREQQFRMWFDPTSHFHTYSIIWTPRTILFLVDETPIREFKNMEAMGVPFPKHQPVRLYSSLWNADEWATRGGLVKTDWSKAPFTASYRNFNVKSGAFLRRNMQVHSQKLKWVRDNHMIYNYCTDNKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028345`
TK1151 ID	TkA07G145070
OH-1004 ID	LXL04_028345
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 88.710 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028345

Location Chr06:38556678-38558364 (+)

Description Similar to XTH15: Xyloglucan endotransglucosylase/hydrolase protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14130`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	Distinct catalytic capacities of two aluminium-repressed Arabidopsis thaliana xyloglucan endotransglucosylase/hydrolases, XTH15 and XTH31, heterologously produced in Pichia.2015 · DOI: 10.1016/j.phytochem.2014.09.020
`At4g25810`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g30270`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At5g57550`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028345 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009828 plant-type cell wall loosening Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009835 fruit ripening Biological Process

GO:0010218 response to far red light Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT4G14130

ath:AT4G25810

ath:AT4G30270

ath:AT5G57550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.296

Rank 1 · LXL04_028345 · OH-1004

Lysosome / Vacuole0.286

Rank 2 · LXL04_028345 · OH-1004

Golgi apparatus0.167

Rank 3 · LXL04_028345 · OH-1004

Endoplasmic reticulum0.157

Rank 4 · LXL04_028345 · OH-1004

Cytoplasm0.141

Rank 5 · LXL04_028345 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722.29Glyco_hydro_1635-213 aa

PF06955.20XET_C239-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028345	`PF00722.29`	Glyco_hydro_16	35	213	3.4e-66	222.7
LXL04_028345	`PF06955.20`	XET_C	239	269	9.3e-17	61.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38911`	Arabidopsis thaliana	Xyloglucan endotransglucosylase/hydrolase protein 15	62.116%	Swiss-Prot	strong database homology
`Q38910`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 23	61.672%	Swiss-Prot	strong database homology
`P24806`	Arabidopsis thaliana	Xyloglucan endotransglucosylase/hydrolase protein 24	62.313%	Swiss-Prot	strong database homology
`Q38907`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 25	65.074%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card