Gene Card
Gene overview
cDNA / CDS / Protein Sequences
825 bp · LXL04_028337|LXL04_028337|OH1004|cDNA
ATGGCCCTCCGGTTGCCACCTGCTCCCTTCCGCCACCCCTCCGCCCCTCAACCGACGACGATGAAGACTCATTTCCTCAGTAAATCATCTTCCTCACCTCGTCTTGCTAAGTTCTCCGTCCGGAATGCCTCTTCCGACAGCTCGCGCAAGGCAAATTTATCCATTTTTTTATTAGTTATGAAGGTGAAAGAGAAGCTTGAGAAAGACCATTTCAGTCTTCCTACAGGAAAAAATGGAAGAGATGATGAGGATATGATTCT...
825 bp · LXL04_028337|LXL04_028337|OH1004|CDS
ATGGCCCTCCGGTTGCCACCTGCTCCCTTCCGCCACCCCTCCGCCCCTCAACCGACGACGATGAAGACTCATTTCCTCAGTAAATCATCTTCCTCACCTCGTCTTGCTAAGTTCTCCGTCCGGAATGCCTCTTCCGACAGCTCGCGCAAGGCAAATTTATCCATTTTTTTATTAGTTATGAAGGTGAAAGAGAAGCTTGAGAAAGACCATTTCAGTCTTCCTACAGGAAAAAATGGAAGAGATGATGAGGATATGATTCT...
Protein
Download Protein FASTA274 aa · LXL04_028337|LXL04_028337|OH1004|PROTEIN
MALRLPPAPFRHPSAPQPTTMKTHFLSKSSSSPRLAKFSVRNASSDSSRKANLSIFLLVMKVKEKLEKDHFSLPTGKNGRDDEDMILWYLKDRRFSVEEAISKLTKTIKWRHEFGVSELTEESVRRVYATGKSYVHDSLDVNGRPVLVVVPAKHTPDMFDRIEDERLCVFLLEKAISRLPEGKEEILGIFDLRGFGTKNADLKFLTFFFEVLYYHYPQRVGQVLFIDAPYIFQPIWQLAKPLIKHYASLARFCSVEDVRK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_028337 |
|---|---|
| TK1151 ID | TkA07G144610 |
| OH-1004 ID | LXL04_028337 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.000 |
| Protein coverage (%) | TK1151 90.650 / OH-1004 83.942Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_028337 |
|---|---|
| Location | Chr06:38432942-38436106 (-) |
| Description | Similar to pitC: Phosphatidylinositol transfer protein 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006935 chemotaxis Biological Process GO:0015914 phospholipid transport Biological Process GO:0051260 protein homooligomerization Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:0140042 lipid droplet formation Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0012505 endomembrane system Cellular Component GO:0016020 membrane Cellular Component GO:0044232 organelle membrane contact site Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0269182 hsa:158747 mmu:76763 spo:2539120 spo:2543637 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00650.26CRAL_TRIO130-248 aaPF13716.12CRAL_TRIO_2143-229 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_028337 | PF00650.26 | CRAL_TRIO | 130 | 248 | 2.6e-25 | 89.7 |
| LXL04_028337 | PF13716.12 | CRAL_TRIO_2 | 143 | 229 | 4.8e-07 | 30.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.