LXL04_028264 | RubberDandelionOmics

Gene overview

LXL04_028264

Reference: OH-1004 Chr: Chr06 Coordinates: 36352093-36353938 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_028264|LXL04_028264|OH1004|cDNA

ATGGCAGCAAGTAGCTCCGCTTCAAATCCAGTTCTATGTGCTTCTTTCAATCAAGACAACAGTTGCTTCGTAATTGGGACGAAAGATGGTTTCAGAATCTTCGATTCGAAGACAGGGAGACTCCTATATGAACGAGTTATTGGAGCATTTGTTATCGTTGAAATGCTTTTCACCTCTAGTCTTCTTGCCATTGTTGGAGCTGGTGAAGAGGCATCTTTATCACCCAGGCGTTTATGCTTGTTCAACACTGAAACTGGAAC...

CDS

Download CDS FASTA

1119 bp · LXL04_028264|LXL04_028264|OH1004|CDS

ATGGCAGCAAGTAGCTCCGCTTCAAATCCAGTTCTATGTGCTTCTTTCAATCAAGACAACAGTTGCTTCGTAATTGGGACGAAAGATGGTTTCAGAATCTTCGATTCGAAGACAGGGAGACTCCTATATGAACGAGTTATTGGAGCATTTGTTATCGTTGAAATGCTTTTCACCTCTAGTCTTCTTGCCATTGTTGGAGCTGGTGAAGAGGCATCTTTATCACCCAGGCGTTTATGCTTGTTCAACACTGAAACTGGAAC...

Protein

Download Protein FASTA

372 aa · LXL04_028264|LXL04_028264|OH1004|PROTEIN

MAASSSASNPVLCASFNQDNSCFVIGTKDGFRIFDSKTGRLLYERVIGAFVIVEMLFTSSLLAIVGAGEEASLSPRRLCLFNTETGTALRELNFLTSILSVFVNRKRLIVVLQLKTFIYDINSLVILDTIDTVPNLKGVCAFSPCLDGCFLALPASTTKGSVLVYNVMDLHSHCEIDAHKSPLAAIVFSSNGMYIATASEQGTLIRVHSVLEATKSYSFRRGTYPSTIYSLSFGPCTGLPEVVIATSSSGSVHAFFLEMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028264`
TK1151 ID	TkA07G137180
OH-1004 ID	LXL04_028264
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028264

Location Chr06:36352093-36353938 (+)

Description Similar to ATG18B: Autophagy-related protein 18b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30510`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028264 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000425 pexophagy Biological Process

GO:0006914 autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0034497 protein localization to phagophore assembly site Biological Process

GO:0044804 nucleophagy Biological Process

GO:0061723 glycophagy Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0034045 phagophore assembly site membrane Cellular Component

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ang:An18g03070

ath:AT4G30510

yli:2908106

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · LXL04_028264 · OH-1004

Nucleus0.221

Rank 2 · LXL04_028264 · OH-1004

Lysosome / Vacuole0.165

Rank 3 · LXL04_028264 · OH-1004

Golgi apparatus0.157

Rank 4 · LXL04_028264 · OH-1004

Cell membrane0.119

Rank 5 · LXL04_028264 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21032.3PROPPIN12-273 aa

PF24814.2WD40_Prp19118-206 aa

PF25175.2Beta-prop_WDR5147-236 aa

PF23414.2Beta-prop_EML_2147-216 aa

PF25174.2Beta-prop_THOC3155-232 aa

PF23381.2Beta-prop_IFT122_1st156-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028264	`PF21032.3`	PROPPIN	12	273	5.1e-41	141.7
LXL04_028264	`PF24814.2`	WD40_Prp19	118	206	5.7e-08	32.9
LXL04_028264	`PF25175.2`	Beta-prop_WDR5	147	236	5e-08	33.3
LXL04_028264	`PF23414.2`	Beta-prop_EML_2	147	216	4.7e-07	30.2
LXL04_028264	`PF25174.2`	Beta-prop_THOC3	155	232	4.2e-07	30.0
LXL04_028264	`PF23381.2`	Beta-prop_IFT122_1st	156	237	1.8e-08	34.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1Q8`	Arabidopsis thaliana	Autophagy-related protein 18b	73.481%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card