LXL04_028253 | RubberDandelionOmics

Gene overview

LXL04_028253

Reference: OH-1004 Chr: Chr06 Coordinates: 35942761-35945865 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2892 bp · LXL04_028253|LXL04_028253|OH1004|cDNA

ATGAATCCACAAAAACTGCATTCCCTTTTCTTCTCCACAGTTTTCTTTTCAATAGTTTCAGGAGACGAAAAAGCTCAAATTTTTAACGACCGAGCTTCTCTCCTCACGTTCTTTTCCGGCGTCGTTTCTGATCCCGGAAACATTCTTCATAACTGGAACAGTTCTTTGATTCCAGTCTGTAACTGGACCGGAATCACATGCAATCAGAATCGTGATTTCGTTCTTGAGTTAGATCTAAGTGGAGCTTCACTCCATGGGAT...

CDS

Download CDS FASTA

2892 bp · LXL04_028253|LXL04_028253|OH1004|CDS

ATGAATCCACAAAAACTGCATTCCCTTTTCTTCTCCACAGTTTTCTTTTCAATAGTTTCAGGAGACGAAAAAGCTCAAATTTTTAACGACCGAGCTTCTCTCCTCACGTTCTTTTCCGGCGTCGTTTCTGATCCCGGAAACATTCTTCATAACTGGAACAGTTCTTTGATTCCAGTCTGTAACTGGACCGGAATCACATGCAATCAGAATCGTGATTTCGTTCTTGAGTTAGATCTAAGTGGAGCTTCACTCCATGGGAT...

Protein

Download Protein FASTA

963 aa · LXL04_028253|LXL04_028253|OH1004|PROTEIN

MNPQKLHSLFFSTVFFSIVSGDEKAQIFNDRASLLTFFSGVVSDPGNILHNWNSSLIPVCNWTGITCNQNRDFVLELDLSGASLHGIISPAISRLSRLKVLDLSRNFFEGGIPGEIGYLSELKQLSLSSNLLRGRIPFELGFLSKIQYLDLGSNRLVGDIPMALFCNGTSVLEYVDLSNNSISGPIPFTEECEISELRFLLVWSNKLTGRIPSALANSSKLKWLDLEVNGFEGELPFEIVKNLSNLQFVYLSYNRFSGPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028253`
TK1151 ID	TkA07G134470
OH-1004 ID	LXL04_028253
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028253

Location Chr06:35942761-35945865 (-)

Description Similar to At2g24130: Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24130`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130.	No verified direct reference in this release
`At3g47570`	Probable LRR receptor-like serine/threonine-protein kinase At3g47570.	No verified direct reference in this release
`At5g20480`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs); phosphorylates BIK1 upon elicitation to regulate immune responses such as defense hormone expression (e.g. jasmonic acid (JA) and salicylic acid (SA)).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0569733`	Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity.	Cleavage and nuclear localization of the rice XA21 immune receptor.2012 · DOI: 10.1038/ncomms1932
`UniProt: Q1MX30`	Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028253 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002764 immune response-regulating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G24130

ath:AT3G47570

ath:AT5G20480

osa:107276510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.864

Rank 1 · LXL04_028253 · OH-1004

Endoplasmic reticulum0.091

Rank 2 · LXL04_028253 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_028253 · OH-1004

Nucleus0.042

Rank 4 · LXL04_028253 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_028253 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_229-68 aa

PF13855.13LRR_876-132 aa

PF13855.13LRR_8298-356 aa

PF13855.13LRR_8364-404 aa

PF12799.14LRR_4393-431 aa

PF23598.2LRR_14393-552 aa

PF13855.13LRR_8415-453 aa

PF00069.32Pkinase660-945 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028253	`PF08263.18`	LRRNT_2	29	68	4.9e-10	40.2
LXL04_028253	`PF13855.13`	LRR_8	76	132	1.9e-39	133.9
LXL04_028253	`PF13855.13`	LRR_8	298	356	1.9e-39	133.9
LXL04_028253	`PF13855.13`	LRR_8	364	404	1.9e-39	133.9
LXL04_028253	`PF12799.14`	LRR_4	393	431	1.5e-32	111.5
LXL04_028253	`PF23598.2`	LRR_14	393	552	8.9e-23	81.3
LXL04_028253	`PF13855.13`	LRR_8	415	453	1.9e-39	133.9
LXL04_028253	`PF00069.32`	Pkinase	660	945	1.2e-42	146.9
LXL04_028253	`PF07714.24`	PK_Tyr_Ser-Thr	662	946	4.9e-39	134.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUI0`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130	57.918%	Swiss-Prot	strong database homology
`C0LGP4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At3g47570	35.905%	Swiss-Prot	moderate database homology
`C0LGT6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase EFR	34.745%	Swiss-Prot	moderate database homology
`Q2R2D5`	Oryza sativa subsp. japonica	Receptor kinase-like protein Xa21	34.843%	Swiss-Prot	moderate database homology
`Q1MX30`	Oryza sativa subsp. indica	Receptor kinase-like protein Xa21	35.347%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card