LXL04_028236 | RubberDandelionOmics

Gene overview

LXL04_028236

Reference: OH-1004 Chr: Chr06 Coordinates: 35449715-35450570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · LXL04_028236|LXL04_028236|OH1004|cDNA

ATGGATGCTTCTACTTGCCTTTTCAGTATCTTGAACACATCTATACCCGAGAAGGTCGATCTTTTCATAGGCAAACCTATCGAGTCGGAGATCACAACAGCCGATATTTTAAAGGGCGTCGTATCCACGATATTTGACTATGCTGTTCAAGAACCCACGTTTTGCCCCATGTTTGCCCAGTTATGCTCGGATCTCAAAAGGAAGCTCGACCCATTTCCATCCGACGAGCCTGGTGGATTGGAGATCAGAATTAGGCGAGT...

CDS

Download CDS FASTA

666 bp · LXL04_028236|LXL04_028236|OH1004|CDS

ATGGATGCTTCTACTTGCCTTTTCAGTATCTTGAACACATCTATACCCGAGAAGGTCGATCTTTTCATAGGCAAACCTATCGAGTCGGAGATCACAACAGCCGATATTTTAAAGGGCGTCGTATCCACGATATTTGACTATGCTGTTCAAGAACCCACGTTTTGCCCCATGTTTGCCCAGTTATGCTCGGATCTCAAAAGGAAGCTCGACCCATTTCCATCCGACGAGCCTGGTGGATTGGAGATCAGAATTAGGCGAGT...

Protein

Download Protein FASTA

221 aa · LXL04_028236|LXL04_028236|OH1004|PROTEIN

MDASTCLFSILNTSIPEKVDLFIGKPIESEITTADILKGVVSTIFDYAVQEPTFCPMFAQLCSDLKRKLDPFPSDEPGGLEIRIRRVMLNTCQHAFEGLEKLREQRRQMNATIKESASSDKENIVKPRALFIEELKSPHDYPEFVKEAIYLFLNRSPPCVEPIAKLLDYMLLKKILVQTDLRTGCRANASLLDDFADNYLELATTDFGEIMGPDIWCCLVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028236`
TK1151 ID	TkA07G132740
OH-1004 ID	LXL04_028236
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 93.525 / OH-1004 58.824 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028236

Location Chr06:35449715-35450570 (+)

Description Similar to Os04g0499300: Eukaryotic translation initiation factor isoform 4G-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57870`	Plays a role in the accumulation of some potyvirus during viral infection.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0499300`	Plays a role in the accumulation of a sobemovirus (RYMV) during viral infection.	No verified direct reference in this release
`Os02g0611500`	Plays a role in the accumulation of a sobemovirus (RYMV) during viral infection.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028236 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006413 translational initiation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009536 plastid Cellular Component

GO:0016281 eukaryotic translation initiation factor 4F complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

KEGG gene cross-reference

ath:AT5G57870

dosa:Os02g0611500

dosa:Os04g0499300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.541

Rank 1 · LXL04_028236 · OH-1004

Nucleus0.268

Rank 2 · LXL04_028236 · OH-1004

Extracellular0.124

Rank 3 · LXL04_028236 · OH-1004

Mitochondrion0.073

Rank 4 · LXL04_028236 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_028236 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02854.26MIF4G9-108 aa

PF02847.24MA3106-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028236	`PF02854.26`	MIF4G	9	108	2.9e-12	47.4
LXL04_028236	`PF02847.24`	MA3	106	211	3.5e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZT6`	Arabidopsis thaliana	Eukaryotic translation initiation factor isoform 4G-1	58.036%	Swiss-Prot	moderate database homology
`Q84PB3`	Oryza sativa subsp. japonica	Eukaryotic translation initiation factor isoform 4G-1	52.597%	Swiss-Prot	moderate database homology
`Q6K641`	Oryza sativa subsp. japonica	Eukaryotic translation initiation factor isoform 4G-2	56.557%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card