LXL04_028189 | RubberDandelionOmics

Gene overview

LXL04_028189

Reference: OH-1004 Chr: Chr06 Coordinates: 33787973-33788663 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · LXL04_028189|LXL04_028189|OH1004|cDNA

ATGTTAATCTTTTCAAACAACTGCAAATCCATTGCTCTTCCTACTGGCCAAACTGCAGAGGTTGCCATGCTGGCATACGAGTATGGAAAAAATCTCGGTTTGGCATTCCAATTGATAGATGATGTTCTTGATTTTACCGGCACATCATCATCTCTCGGGAAAGGCGCATTATCTGACATTCACCATGGGATTATAACAACTCCGATATTATATGCAATGGAGGATTTTCCGGAACTACGTACAGTTGTCGACAGGGGATT...

CDS

Download CDS FASTA

519 bp · LXL04_028189|LXL04_028189|OH1004|CDS

ATGTTAATCTTTTCAAACAACTGCAAATCCATTGCTCTTCCTACTGGCCAAACTGCAGAGGTTGCCATGCTGGCATACGAGTATGGAAAAAATCTCGGTTTGGCATTCCAATTGATAGATGATGTTCTTGATTTTACCGGCACATCATCATCTCTCGGGAAAGGCGCATTATCTGACATTCACCATGGGATTATAACAACTCCGATATTATATGCAATGGAGGATTTTCCGGAACTACGTACAGTTGTCGACAGGGGATT...

Protein

Download Protein FASTA

172 aa · LXL04_028189|LXL04_028189|OH1004|PROTEIN

MLIFSNNCKSIALPTGQTAEVAMLAYEYGKNLGLAFQLIDDVLDFTGTSSSLGKGALSDIHHGIITTPILYAMEDFPELRTVVDRGLDDPANVNLVSYVPIKFIKSNILSPLSKSSLIQALEYLGKSHGIQRTRELAAKKHASLASAAIDSLPENDDEDVQRSKRALIELTH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028189`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028189

Location Chr06:33787973-33788663 (-)

Description Similar to SPS3: Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34630`	May be involved in the supply of solanesyl diphosphate for ubiquinone-9 (UQ-9) biosynthesis in mitochondria.	Gene network reconstruction identifies the authentic trans-prenyl diphosphate synthase that makes the solanesyl moiety of ubiquinone-9 in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04796.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0678200`	Involved in the supply of solanesyl diphosphate for ubiquinone-9 (UQ-9) biosynthesis in mitochondria.	No verified direct reference in this release
`Os12g0271700`	Involved in providing solanesyl diphosphate for plastoquinone-9 (PQ-9) formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028189 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006743 ubiquinone metabolic process Biological Process

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Biological Process

GO:0010236 plastoquinone biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0032476 polyprenyl diphosphate synthase complex Cellular Component

GO:0032478 heterotetrameric polyprenyl diphosphate synthase complex Cellular Component

KEGG gene cross-reference

ath:AT2G34630

ddi:DDB_G0280293

dosa:Os06g0678200

dosa:Os12g0271700

osa:4351957

yli:2909963

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.631

Rank 1 · LXL04_028189 · OH-1004

Nucleus0.282

Rank 2 · LXL04_028189 · OH-1004

Peroxisome0.133

Rank 3 · LXL04_028189 · OH-1004

Mitochondrion0.075

Rank 4 · LXL04_028189 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_028189 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00348.23polyprenyl_synt4-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028189	`PF00348.23`	polyprenyl_synt	4	85	7.7e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5HZ00`	Arabidopsis thaliana	Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial	62.353%	Swiss-Prot	strong database homology
`Q653T6`	Oryza sativa subsp. japonica	Solanesyl-diphosphate synthase 1, mitochondrial	57.988%	Swiss-Prot	strong database homology
`Q0INZ4`	Oryza sativa subsp. japonica	Probable solanesyl-diphosphate synthase 3, chloroplastic	33.117%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card