LXL04_028151 | RubberDandelionOmics

Gene overview

LXL04_028151

Reference: OH-1004 Chr: Chr06 Coordinates: 32584305-32585491 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1012 bp · LXL04_028151|LXL04_028151|OH1004|cDNA

TTGCAAGTGGCCCCACTCGCGCCGTCGTGTATTATCCAGGAACACACAAAGTCACACCTACATATCAAAACGCTTCCTTTCTCTCCACCTCCTTCCGTCATGCTCCGTCGTCACCATGGGCTGCTCAACCACAACCACCACTACCTACGCGACGCTCCCTCAGTATCCTCCTCCTTCAACCCCTCTTTCCAAACTCCACCTTCACCGCCGCTCTCTGCTCTTCctctccaccacctccaccgcccTCTCCATcccctctc...

CDS

Download CDS FASTA

897 bp · LXL04_028151|LXL04_028151|OH1004|CDS

ATGGGCTGCTCAACCACAACCACCACTACCTACGCGACGCTCCCTCAGTATCCTCCTCCTTCAACCCCTCTTTCCAAACTCCACCTTCACCGCCGCTCTCTGCTCTTCCTCTCCACCACCTCCACCGCCCTCTCCATCCCCTCTCTCTCCACAGCCTCACCGCCACAAAAACAACCCGACACCACCATTACTGACCGCGTCTTCATGGACTTCAGCATCTGCCCTAGCTACTTCCAAACCCGAACCCTAGGATCTGATCT...

Protein

Download Protein FASTA

298 aa · LXL04_028151|LXL04_028151|OH1004|PROTEIN

MGCSTTTTTTYATLPQYPPPSTPLSKLHLHRRSLLFLSTTSTALSIPSLSTASPPQKQPDTTITDRVFMDFSICPSYFQTRTLGSDLAQCPDMEPVGRIVLGLYGNLVPITVSNFKSMCTGVSGYYKGTLIQKIFPGRFFMAGHQGRRDKGEVKPPRGMVRNTESIDPKAFQLRHTKGGILSLCLSENDDDDDIKLDPDYHNVEFMITTGPGPCPDLDGRNIVFGAVLEGMDVVANISAIPTYKPGESIRQYNDLAEFLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028151`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028151

Location Chr06:32584305-32585491 (-)

Description Similar to CYP28: Peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35100`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028151 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000413 protein peptidyl-prolyl isomerization Biological Process

GO:0006457 protein folding Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0031978 plastid thylakoid lumen Cellular Component

KEGG gene cross-reference

afm:AFUA_4G07650

ath:AT5G35100

lgi:LOTGIDRAFT_222979

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · LXL04_028151 · OH-1004

Mitochondrion0.022

Rank 2 · LXL04_028151 · OH-1004

Nucleus0.018

Rank 3 · LXL04_028151 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_028151 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_028151 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00160.27Pro_isomerase96-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028151	`PF00160.27`	Pro_isomerase	96	244	4.4e-20	73.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65220`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic	59.783%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card