LXL04_027982 | RubberDandelionOmics

Gene overview

LXL04_027982

Reference: OH-1004 Chr: Chr06 Coordinates: 28167050-28169203 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_027982|LXL04_027982|OH1004|cDNA

ATGCGGAGCATGACGACTCTCTGTTCATCGACAGAGAGCGTGTCGACGATGAGGAGGACGACGTCCTTTTCGATTCAATCAACTTCTTCTAAATCCTTGAAACACTTTCGATGTTTTTTCGGTTCCAATGTTCCGTCTGGTCATACTTCTCAACGTCGCCTTTTCTCCAGGCAGTTGAGGCAATTTCAGCTCTCGCGATCCGGTACGAATGTTAATTGTGTGGATGCAACAAAACCGACTCACAATGTGGAGGATTTGGA...

CDS

Download CDS FASTA

1131 bp · LXL04_027982|LXL04_027982|OH1004|CDS

ATGCGGAGCATGACGACTCTCTGTTCATCGACAGAGAGCGTGTCGACGATGAGGAGGACGACGTCCTTTTCGATTCAATCAACTTCTTCTAAATCCTTGAAACACTTTCGATGTTTTTTCGGTTCCAATGTTCCGTCTGGTCATACTTCTCAACGTCGCCTTTTCTCCAGGCAGTTGAGGCAATTTCAGCTCTCGCGATCCGGTACGAATGTTAATTGTGTGGATGCAACAAAACCGACTCACAATGTGGAGGATTTGGA...

Protein

Download Protein FASTA

376 aa · LXL04_027982|LXL04_027982|OH1004|PROTEIN

MRSMTTLCSSTESVSTMRRTTSFSIQSTSSKSLKHFRCFFGSNVPSGHTSQRRLFSRQLRQFQLSRSGTNVNCVDATKPTHNVEDLECSTSYKSYSRYKLTPKTSIPFKDLSSETSWNSYLKLMLFFGIFTLQDSQIALAGTDVGNLIQASSFFGDLSDLSTGFASAFLLIFFSELGDKTFFIAALLAARNSAAVVFLGTFGALGVMTIISVVLGRTFHYVDEILPFRFGDVDLPLDDIAAALLLVYFGVSTLLDASSGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027982`
TK1151 ID	TkA07G110850
OH-1004 ID	LXL04_027982
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027982

Location Chr06:28167050-28169203 (+)

Description Similar to PAM71: Protein PAM71, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64150`	Mn(2+)/H(+) exchanger, which transport Mn(2+)from the chloroplast stroma into the acidic thylakoid lumen.	The Evolutionarily Conserved Protein PHOTOSYNTHESIS AFFECTED MUTANT71 Is Required for Efficient Manganese Uptake at the Thylakoid Membrane in Arabidopsis.2016 · DOI: 10.1105/tpc.15.00812 A Putative Chloroplast-Localized Ca(2+)/H(+) Antiporter CCHA1 Is Involved in Calcium and pH Homeostasis and Required for PSII Function in Arabidopsis.2016 · DOI: 10.1016/j.molp.2016.05.015
`At4g13590`	Probable chloroplast-localized Mn(2+)/H(+) and/or Ca(2+)/H(+) antiporter regulating Ca(2+), Mn(2+) and pH homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AAM2`	GDT1-like protein 1, chloroplastic.	No verified direct reference in this release
`Os01g0221700`	GDT1-like protein 1, chloroplastic.	No verified direct reference in this release
`Os11g0544500`	GDT1-like protein 2, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027982 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0010270 photosystem II oxygen evolving complex assembly Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0032468 Golgi calcium ion homeostasis Biological Process

GO:0032472 Golgi calcium ion transport Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071421 manganese ion transmembrane transport Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64150

ath:AT4G13590

dosa:Os11g0544500

osa:9272318

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.988

Rank 1 · LXL04_027982 · OH-1004

Mitochondrion0.018

Rank 2 · LXL04_027982 · OH-1004

Cytoplasm0.016

Rank 3 · LXL04_027982 · OH-1004

Nucleus0.015

Rank 4 · LXL04_027982 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_027982 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01169.26GDT1164-258 aa

PF01169.26GDT1292-373 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027982	`PF01169.26`	GDT1	164	258	6e-41	139.3
LXL04_027982	`PF01169.26`	GDT1	292	373	6e-41	139.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AX5`	Arabidopsis thaliana	Protein PAM71, chloroplastic	64.035%	Swiss-Prot	strong database homology
`Q9T0H9`	Arabidopsis thaliana	Protein PAM71-homolog, chloroplastic	48.649%	Swiss-Prot	moderate database homology
`B8AAM2`	Oryza sativa subsp. indica	GDT1-like protein 1, chloroplastic	72.984%	Swiss-Prot	moderate database homology
`Q5NAY7`	Oryza sativa subsp. japonica	GDT1-like protein 1, chloroplastic	72.581%	Swiss-Prot	moderate database homology
`Q2R2Z4`	Oryza sativa subsp. japonica	GDT1-like protein 2, chloroplastic	45.778%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card