LXL04_027957 | RubberDandelionOmics

Gene overview

LXL04_027957

Reference: OH-1004 Chr: Chr06 Coordinates: 27674863-27675592 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · LXL04_027957|LXL04_027957|OH1004|cDNA

atgtCAATTACTGATCAAATAagATCCCACCCACCCCGTTTACGTCAAATCTCACTGTGTCTCTTTTCTCCCATCTCCGCCTCCCGCCTGCGTCTTCCTCGTCGCGACCACAGCGCCGTTCTGCAGCCCCCATCTCGCTGTTTTCTTCTCCATTCCGACCCTCGGCAGACGTGCTTCGCGACCCCGACGACCAACAGAAAACCCTCGACGTCGCGACCTCCTTCTTCCCCATCGCGATACCCTGTTGTTCGCTGCCCATC...

CDS

Download CDS FASTA

666 bp · LXL04_027957|LXL04_027957|OH1004|CDS

ATGTCAATTACTGATCAAATAAGATCCCACCCACCCCGTTTACGTCAAATCTCACTGTGTCTCTTTTCTCCCATCTCCGCCTCCCGCCTGCGTCTTCCTCGTCGCGACCACAGCGCCGTTCTGCAGCCCCCATCTCGCTGTTTTCTTCTCCATTCCGACCCTCGGCAGACGTGCTTCGCGACCCCGACGACCAACAGAAAACCCTCGACGTCGCGACCTCCTTCTTCCCCATCGCGATACCCTGTTGTTCGCTGCCCATC...

Protein

Download Protein FASTA

221 aa · LXL04_027957|LXL04_027957|OH1004|PROTEIN

MSITDQIRSHPPRLRQISLCLFSPISASRLRLPRRDHSAVLQPPSRCFLLHSDPRQTCFATPTTNRKPSTSRPPSSPSRYPVVRCPSLSSLLDRRTSTGATVRYSEVYSNVRRDVLDECLSILGMERHSIEEIQRIEWKILDEKAKKWILAVKVVVRVLLFGEKRLCEQVFNESELIQYICFVETTKGCVMQLLNFGEAVAIGERSSEKLFRILDMYEETL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027957`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027957

Location Chr06:27674863-27675592 (-)

Description Similar to EXO70B1: Exocyst complex component EXO70B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58430`	Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.	Arabidopsis exocyst subcomplex containing subunit EXO70B1 is involved in autophagy-related transport to the vacuole.2013 · DOI: 10.1111/tra.12101 The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347
`At5g03540`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	AtEXO70A1, a member of a family of putative exocyst subunits specifically expanded in land plants, is important for polar growth and plant development.2006 · DOI: 10.1111/j.1365-313x.2006.02854.x Arabidopsis exocyst subunits SEC8 and EXO70A1 and exocyst interactor ROH1 are involved in the localized deposition of seed coat pectin.2010 · DOI: 10.1111/j.1469-8137.2010.03372.x The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 The exocyst complex contributes to PIN auxin efflux carrier recycling and polar auxin transport in Arabidopsis.2013 · DOI: 10.1111/tpj.12074 EXO70A1-mediated vesicle trafficking is critical for tracheary element development in Arabidopsis.2013 · DOI: 10.1105/tpc.113.112144 Microtubule-dependent targeting of the exocyst complex is necessary for xylem development in Arabidopsis.2017 · DOI: 10.1111/nph.14267
`At5g52350`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At5g61010`	Influences the subcellular localization patterns of other exocyst complex proteins (e.g. SEC5A, SEC15A, SEC15B and EXO84B) leading to their recruitment to exocyst, well-defined large punctate structures throughout the cytosol.	EXPO, an exocyst-positive organelle distinct from multivesicular endosomes and autophagosomes, mediates cytosol to cell wall exocytosis in Arabidopsis and tobacco cells.2010 · DOI: 10.1105/tpc.110.080697 Exo70E2 is essential for exocyst subunit recruitment and EXPO formation in both plants and animals.2014 · DOI: 10.1091/mbc.e13-10-0586
`At1g07000`	Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.	The role for the exocyst complex subunits Exo70B2 and Exo70H1 in the plant-pathogen interaction.2011 · DOI: 10.1093/jxb/erq402 The ubiquitin ligase PUB22 targets a subunit of the exocyst complex required for PAMP-triggered responses in Arabidopsis.2012 · DOI: 10.1105/tpc.112.104463 The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027957 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006887 exocytosis Biological Process

GO:0006952 defense response Biological Process

GO:0006955 immune response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G07000

ath:AT5G03540

ath:AT5G52350

ath:AT5G58430

ath:AT5G61010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.507

Rank 1 · LXL04_027957 · OH-1004

Cytoplasm0.451

Rank 2 · LXL04_027957 · OH-1004

Cell membrane0.087

Rank 3 · LXL04_027957 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_027957 · OH-1004

Mitochondrion0.045

Rank 5 · LXL04_027957 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03081.23Exo70_C146-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027957	`PF03081.23`	Exo70_C	146	219	2.2e-19	70.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGH9`	Arabidopsis thaliana	Exocyst complex component EXO70B1	38.406%	Swiss-Prot	moderate database homology
`Q9LZD3`	Arabidopsis thaliana	Exocyst complex component EXO70A1	38.028%	Swiss-Prot	moderate database homology
`F4KG58`	Arabidopsis thaliana	Exocyst complex component EXO70A3	35.211%	Swiss-Prot	moderate database homology
`Q9FNR3`	Arabidopsis thaliana	Exocyst complex component EXO70E2	39.130%	Swiss-Prot	moderate database homology
`Q9LMJ4`	Arabidopsis thaliana	Exocyst complex component EXO70B2	35.821%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card