LXL04_027912 | RubberDandelionOmics

Gene overview

LXL04_027912

Reference: OH-1004 Chr: Chr06 Coordinates: 26423273-26428343 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2658 bp · LXL04_027912|LXL04_027912|OH1004|cDNA

ATGatctttcttcttcatttgTTCATTTCGTGTATTACTTTTGTTATTGTTCATGGACAAGTTCAAACAGGTTATATAAGCATTGATTGTGGATCACCAGAAAACTTCAACTATGTGGATCTAGATACGGGTATAAGTTACACGTCAGATGGATCATTTATAGCCACAGGAGTAAACAGAAACATTTCTTCACAATACGCGTATCCAAACAACCCAATGCTCCCACAACCTCTTTCTGATCTTAGAACTTTCCCACAAGG...

CDS

Download CDS FASTA

2658 bp · LXL04_027912|LXL04_027912|OH1004|CDS

ATGATCTTTCTTCTTCATTTGTTCATTTCGTGTATTACTTTTGTTATTGTTCATGGACAAGTTCAAACAGGTTATATAAGCATTGATTGTGGATCACCAGAAAACTTCAACTATGTGGATCTAGATACGGGTATAAGTTACACGTCAGATGGATCATTTATAGCCACAGGAGTAAACAGAAACATTTCTTCACAATACGCGTATCCAAACAACCCAATGCTCCCACAACCTCTTTCTGATCTTAGAACTTTCCCACAAGG...

Protein

Download Protein FASTA

885 aa · LXL04_027912|LXL04_027912|OH1004|PROTEIN

MIFLLHLFISCITFVIVHGQVQTGYISIDCGSPENFNYVDLDTGISYTSDGSFIATGVNRNISSQYAYPNNPMLPQPLSDLRTFPQGDKNCYTLKPNGGKSSLNLIRATFMYGNWDGENKLPQFDLYLDVNLWLSVKFINASDVVTTEIISVALQDTFSVCLVNIGQGTPFISGLELRPLHSSIYETDPKISGNLMLFQRLDIGYLNGTGRYVDDIYDRIWSPYGSLSWDSLSTSLDIDVSGNDYRAPSEVMRTAATPKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027912`
TK1151 ID	TkA07G104250
OH-1004 ID	LXL04_027912
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 76.836 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027912

Location Chr06:26423273-26428343 (+)

Description Similar to At4g29180: Probable LRR receptor-like serine/threonine-protein kinase At4g29180

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29180`	Probable LRR receptor-like serine/threonine-protein kinase At4g29180.	No verified direct reference in this release
`At2g19210`	Putative leucine-rich repeat receptor-like protein kinase At2g19210.	No verified direct reference in this release
`At2g19230`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230.	No verified direct reference in this release
`At2g19190`	Involved in innate immune response of plants.	No verified direct reference in this release
`At1g05700`	Probable LRR receptor-like serine/threonine-protein kinase At1g05700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027912 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05700

ath:AT2G19190

ath:AT2G19210

ath:AT2G19230

ath:AT4G29180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.837

Rank 1 · LXL04_027912 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_027912 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_027912 · OH-1004

Lysosome / Vacuole0.043

Rank 4 · LXL04_027912 · OH-1004

Nucleus0.037

Rank 5 · LXL04_027912 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like28-357 aa

PF13855.13LRR_8415-471 aa

PF00560.40LRR_1436-458 aa

PF07714.24PK_Tyr_Ser-Thr571-783 aa

PF00069.32Pkinase572-834 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027912	`PF12819.14`	Malectin_like	28	357	5.9e-106	355.2
LXL04_027912	`PF13855.13`	LRR_8	415	471	3.3e-07	30.7
LXL04_027912	`PF00560.40`	LRR_1	436	458	3.9e-06	26.6
LXL04_027912	`PF07714.24`	PK_Tyr_Ser-Thr	571	783	7.8e-48	163.7
LXL04_027912	`PF00069.32`	Pkinase	572	834	4.8e-45	154.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGR6`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At4g29180	52.244%	Swiss-Prot	strong database homology
`O65924`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like protein kinase At2g19210	45.123%	Swiss-Prot	moderate database homology
`O64556`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230	46.730%	Swiss-Prot	moderate database homology
`O64483`	Arabidopsis thaliana	Senescence-induced receptor-like serine/threonine-protein kinase	45.583%	Swiss-Prot	moderate database homology
`C0LGD6`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g05700	44.917%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card