LXL04_027875 | RubberDandelionOmics

Gene overview

LXL04_027875

Reference: OH-1004 Chr: Chr06 Coordinates: 25372177-25374941 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · LXL04_027875|LXL04_027875|OH1004|cDNA

ATGGCGTCGTACATGAGCATGGGAGAAGCACACAGAAGGATAACAGAGTATTTGAATCGATTCACCGATGTCGTTTCGTACCAAGACGGCAGTTCTCTCAAACAACTTCTTTCTCTGTCCTCTGAATCTCCATCTTTCCTCGCCCTCGCCGATGCCCTCAACATCTTCCAGGATGCTAACAGAGTGATCAGACAAGCAGACAAGTATTCTCAGTATGCGGAAATAGTAGCTCCTTTATTTCGAGCAATGCAGAGTTATAG...

CDS

Download CDS FASTA

1245 bp · LXL04_027875|LXL04_027875|OH1004|CDS

ATGGCGTCGTACATGAGCATGGGAGAAGCACACAGAAGGATAACAGAGTATTTGAATCGATTCACCGATGTCGTTTCGTACCAAGACGGCAGTTCTCTCAAACAACTTCTTTCTCTGTCCTCTGAATCTCCATCTTTCCTCGCCCTCGCCGATGCCCTCAACATCTTCCAGGATGCTAACAGAGTGATCAGACAAGCAGACAAGTATTCTCAGTATGCGGAAATAGTAGCTCCTTTATTTCGAGCAATGCAGAGTTATAG...

Protein

Download Protein FASTA

414 aa · LXL04_027875|LXL04_027875|OH1004|PROTEIN

MASYMSMGEAHRRITEYLNRFTDVVSYQDGSSLKQLLSLSSESPSFLALADALNIFQDANRVIRQADKYSQYAEIVAPLFRAMQSYRVGHFAESYQAFEKSANAFIQEFRNWESAWALEALYVVVYEIRILAERADRELASNGKTPEKLKAAGSFLMKVFGVLAGKGPKRVGALYVTCQLFKVYFKLGTVHLCRSVIRSIETARIFDFEEFPVRDKVTYMYYTGRLEVLNENFPAADHKLSYALSHCDPQSVANIRMILK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027875`
TK1151 ID	TkA07G099480
OH-1004 ID	LXL04_027875
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027875

Location Chr06:25372177-25374941 (-)

Description Similar to EER5: Enhanced ethylene response protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19560`	Involved in the regulation of ethylene response.	The eer5 mutation, which affects a novel proteasome-related subunit, indicates a prominent role for the COP9 signalosome in resetting the ethylene-signaling pathway in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03521.x Arabidopsis homolog of the yeast TREX-2 mRNA export complex: components and anchoring nucleoporin.2010 · DOI: 10.1111/j.1365-313x.2009.04048.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027875 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0016973 poly(A)+ mRNA export from nucleus Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G19560

bta:617943

hsa:55795

mmu:234069

xla:734284

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.565

Rank 1 · LXL04_027875 · OH-1004

Cytoplasm0.552

Rank 2 · LXL04_027875 · OH-1004

Lysosome / Vacuole0.053

Rank 3 · LXL04_027875 · OH-1004

Cell membrane0.049

Rank 4 · LXL04_027875 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_027875 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01399.34PCI305-398 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027875	`PF01399.34`	PCI	305	398	6.3e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWE6`	Arabidopsis thaliana	Enhanced ethylene response protein 5	78.155%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card